Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GGCX antibody - middle region (ARP44340_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP44340_P050-FITC Conjugated

ARP44340_P050-HRP Conjugated

ARP44340_P050-Biotin Conjugated

Gene Symbol:
GGCX
NCBI Gene Id:
2677
Official Gene Full Name:
Gamma-glutamyl carboxylase
Protein Name:
Vitamin K-dependent gamma-carboxylase
Swissprot Id:
P38435
Protein Accession #:
NP_000812
Nucleotide Accession #:
NM_000821
Alias Symbols:
FLJ26629, VKCFD1
Replacement Item:
This antibody may replace item sc-75125 from Santa Cruz Biotechnology.
Description of Target:
GGCX is an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency.Gamma-glutamyl carboxylase accomplishes the posttranslational modification required for the activity of all of the vitamin K-dependent proteins (Wu et al., 1991 [PubMed 1749935]). These include some of the blood coagulation and anticoagulation proteins as well as bone gamma-carboxyglutamic acid (Gla) protein (BGLAP; MIM 112260) and bone matrix protein (MGP; MIM 154870).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
758
Molecular Weight:
87kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GGCX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GGCX.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GGCX
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-GGCX (ARP44340_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; DCP2; FBXO6; F9; F10; F7; F2; PROC; BGLAP;
Blocking Peptide:
For anti-GGCX (ARP44340_P050) antibody is Catalog # AAP44340 (Previous Catalog # AAPS14612)
Datasheets/Manuals:
Printable datasheet for anti-GGCX (ARP44340_P050) antibody
Sample Type Confirmation:

GGCX is strongly supported by BioGPS gene expression data to be expressed in Jurkat, MCF7

Target Reference:
Rieder,M.J., (2007) J. Thromb. Haemost. 5 (11), 2227-2234

Tell us what you think about this item!

Write A Review
    Please, wait...