Search Antibody, Protein, and ELISA Kit Solutions

GGA1 Antibody - C-terminal region (ARP84586_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
GGA1
Official Gene Full Name:
golgi-associated, gamma adaptin ear containing, ARF binding protein 1
NCBI Gene Id:
26088
Protein Name:
ADP-ribosylation factor-binding protein GGA1
Swissprot Id:
Q9UJY5
Protein Accession #:
NP_001001560.1
Nucleotide Accession #:
NM_001001560.2
Description of Target:
This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
639
Molecular Weight:
70 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GGA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GGA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human GGA1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GGA1 (ARP84586_P050) antibody is Catalog # AAP84586
Datasheets/Manuals:
Printable datasheet for anti-GGA1 (ARP84586_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...