Search Antibody, Protein, and ELISA Kit Solutions

GFRA3 Antibody - middle region (ARP81924_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GFRA3
Purification:
Affinity purified
Peptide Sequence:
Synthetic peptide located within the following region: CLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLC
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GFRA3 (ARP81924_P050) antibody is Catalog # AAP81924
Datasheets/Manuals:
Printable datasheet for anti-GFRA3 (ARP81924_P050) antibody
Gene Symbol:
GFRA3
Official Gene Full Name:
GDNF family receptor alpha 3
Alias Symbols:
GDNFR3
NCBI Gene Id:
2676
Protein Name:
GDNF family receptor alpha-3
Description of Target:
The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin.
Swissprot Id:
O60609
Protein Accession #:
NP_001487.2
Nucleotide Accession #:
NM_001496.3
Protein Size (# AA):
400
Molecular Weight:
44 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GFRA3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GFRA3.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...