Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP81924_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

GFRA3 Antibody - middle region (ARP81924_P050)

Catalog#: ARP81924_P050
Domestic: within 24 hours delivery International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GFRA3
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: CLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GFRA3 (ARP81924_P050) antibody is Catalog # AAP81924
Datasheets/Manuals Printable datasheet for anti-GFRA3 (ARP81924_P050) antibody
Gene Symbol GFRA3
Official Gene Full Name GDNF family receptor alpha 3
Alias Symbols GDNFR3
NCBI Gene Id 2676
Protein Name GDNF family receptor alpha-3
Description of Target The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin.
Swissprot Id O60609
Protein Accession # NP_001487.2
Nucleotide Accession # NM_001496.3
Protein Size (# AA) 400
Molecular Weight 44 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GFRA3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GFRA3.
Write Your Own Review
You're reviewing:GFRA3 Antibody - middle region (ARP81924_P050)
Your Rating