GFRA2 Antibody - C-terminal region (ARP54575_P050)

Catalog No: ARP54575_P050

WB Suggested Anti-GFRA2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Host: Rabbit
Target Name: GFRA2
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: GFRA2
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GFRA2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GFRA2 (ARP54575_P050) antibody is Catalog # AAP54575 (Previous Catalog # AAPP31359)

Target Info

• Reference: Lavedan,C., (er) Mol. Psychiatry (2008) In press
• Gene Symbol: GFRA2
• Gene Full Name: GDNF family receptor alpha 2
• Alias Symbols: NTNRA, RETL2, TRNR2, GDNFRB, NRTNR-ALPHA
• NCBI Gene Id: 2675
• Protein Name: GDNF family receptor alpha-2
• Description of Target: Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. GFRA2 is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1.Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1. This gene is a candidate gene for RET-associated diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O00451
• Protein Accession #: NP_001486
• Nucleotide Accession #: NM_001495
• Protein Size (# AA): 464
• Molecular Weight: 47kDa
• Protein Interactions: PTEN; NRTN; GDNF;