Search Antibody, Protein, and ELISA Kit Solutions

GFPT2 Antibody - middle region (ARP42215_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP42215_P050-FITC Conjugated

ARP42215_P050-HRP Conjugated

ARP42215_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
GFPT2
Official Gene Full Name:
Glutamine-fructose-6-phosphate transaminase 2
NCBI Gene Id:
9945
Protein Name:
Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
Swissprot Id:
O94808
Protein Accession #:
NP_005101
Nucleotide Accession #:
NM_005110
Alias Symbols:
FLJ10380, GFAT2
Description of Target:
GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.
Protein Size (# AA):
682
Molecular Weight:
77kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GFPT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GFPT2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GFPT2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-GFPT2 (ARP42215_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; DCP2; CUL3; POT1;
Blocking Peptide:
For anti-GFPT2 (ARP42215_P050) antibody is Catalog # AAP42215 (Previous Catalog # AAPP24638)
Datasheets/Manuals:
Printable datasheet for anti-GFPT2 (ARP42215_P050) antibody
Sample Type Confirmation:

GFPT2 is supported by BioGPS gene expression data to be expressed in HT1080

Target Reference:
Srinivasan,V., Clin. Biochem. 40 (13-14), 952-957 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...