GFM1 Antibody - middle region (ARP77769_P050)

Catalog No: ARP77769_P050

Host: Rabbit
Target Name: GFM1
Sample Tissue: RPMI 8226 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GFM1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: CASGDTFTDKANSGLSMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GFM1 (ARP77769_P050) antibody is Catalog # AAP77769

Target Info

• Gene Symbol: GFM1
• Gene Full Name: G elongation factor, mitochondrial 1
• Alias Symbols: EFG, GFM, EFG1, EFGM, EGF1, hEFG1, COXPD1, mtEF-G1
• NCBI Gene Id: 85476
• Protein Name: elongation factor G, mitochondrial
• Description of Target: Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known.
• Uniprot ID: Q96RP9
• Protein Accession #: NP_001295093.1
• Nucleotide Accession #: NM_001308164.1
• Protein Size (# AA): 751
• Molecular Weight: 82 kDa