GFI1B Antibody - C-terminal region (ARP90462_P050)

Catalog No: ARP90462_P050

Host: Rabbit
Target Name: GFI1B
Sample Tissue: Mouse Spleen lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse GFI1B
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: QVCGKAFSQSSNLITHSRKHTGFKPFSCELCTKGFQRKVDLRRHRESQHN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GFI1B (ARP90462_P050) antibody is Catalog # AAP90462

Target Info

• Gene Symbol: GFI1B
• Gene Full Name: growth factor independent 1B
• Alias Symbols: Gfi-1, Gfi-1B
• NCBI Gene Id: 14582
• Protein Name: zinc finger protein Gfi-1b
• Description of Target: Essential proto-oncogenic transcriptional regulator necessary for development and differentiation of erythroid and megakaryocytic lineages. Component of a RCOR-GFI-KDM1A-HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation. Transcriptional repressor or activator depending on both promoter and cell type context; represses promoter activity of SOCS1 and SOCS3 and thus, may regulate cytokine signaling pathways. Cooperates with GATA1 to repress target gene transcription, such as the apoptosis regulator BCL2L1; GFI1B silencing in leukemic cell lines markedly increase apoptosis rate. Inhibits down-regulation of MYC and MYB as well as the cyclin-dependent kinase inhibitor CDKN1A/P21WAF1 in IL6-treated myelomonocytic cells. Represses expression of GATA3 in T-cell lymphomas and inhibits GATA1-mediated transcription; as GATA1 also mediates erythroid GFI1B transcription, both GATA1 and GFI1B participate in a feedback regulatory pathway controlling the expression of GFI1B gene in erythroid cells. Suppresses GATA1-mediated stimulation of GFI1B promoter through protein interaction. Binds to gamma-satellite DNA and to its own promoter, auto-repressing its own expression. Alters histone methylation by recruiting histone methyltransferase to target genes promoters. Plays a role in heterochromatin formation.
• Uniprot ID: O70237
• Protein Accession #: NP_032140.1
• Nucleotide Accession #: NM_008114.3
• Protein Size (# AA): 330
• Molecular Weight: 36 kDa