Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GFER Antibody - C-terminal region : FITC (ARP61318_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61318_P050 Unconjugated

ARP61318_P050-HRP Conjugated

ARP61318_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
GFER
Official Gene Full Name:
growth factor, augmenter of liver regeneration
NCBI Gene Id:
2671
Protein Name:
FAD-linked sulfhydryl oxidase ALR
Swissprot Id:
P55789
Protein Accession #:
NP_005253
Alias Symbols:
ALR, HPO, HSS, ERV1, HPO1, HPO2, HERV1
Description of Target:
The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.
Protein Size (# AA):
205
Molecular Weight:
22kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GFER.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GFER.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ALR
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
PLEKHF2; BNIPL; SMAD2; COPS5; COPS8; COPS2; GPS1; UBC; GFER; ASCC2; TXN;
Blocking Peptide:
For anti-GFER (ARP61318_P050-FITC) antibody is Catalog # AAP61318
Datasheets/Manuals:
Printable datasheet for anti-GFER (ARP61318_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...