SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61318_P050
Price: $0.00
SKU
ARP61318_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

GFER Antibody - C-terminal region (ARP61318_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-GFER (ARP61318_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human ALR
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: LCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDG
Concentration0.5 mg/ml
Blocking PeptideFor anti-GFER (ARP61318_P050) antibody is Catalog # AAP61318
Gene SymbolGFER
Gene Full Namegrowth factor, augmenter of liver regeneration
Alias SymbolsALR, HPO, HSS, ERV1, HPO1, HPO2, HERV1, MMCHD, MPMCD
NCBI Gene Id2671
Protein NameFAD-linked sulfhydryl oxidase ALR
Description of TargetThe hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.
Uniprot IDP55789
Protein Accession #NP_005253
Protein Size (# AA)205
Molecular Weight22kDa
Protein InteractionsPLEKHF2; BNIPL; SMAD2; COPS5; COPS8; COPS2; GPS1; UBC; GFER; ASCC2; TXN;
  1. What is the species homology for "GFER Antibody - C-terminal region (ARP61318_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "GFER Antibody - C-terminal region (ARP61318_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GFER Antibody - C-terminal region (ARP61318_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GFER Antibody - C-terminal region (ARP61318_P050)"?

    This target may also be called "ALR, HPO, HSS, ERV1, HPO1, HPO2, HERV1, MMCHD, MPMCD" in publications.

  5. What is the shipping cost for "GFER Antibody - C-terminal region (ARP61318_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GFER Antibody - C-terminal region (ARP61318_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GFER Antibody - C-terminal region (ARP61318_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GFER Antibody - C-terminal region (ARP61318_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GFER"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GFER"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GFER"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GFER"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GFER"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GFER"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GFER Antibody - C-terminal region (ARP61318_P050)
Your Rating