Search Antibody, Protein, and ELISA Kit Solutions

Gfap Antibody - N-terminal region (ARP54621_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54621_P050-FITC Conjugated

ARP54621_P050-HRP Conjugated

ARP54621_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Gfap
Official Gene Full Name:
Glial fibrillary acidic protein
NCBI Gene Id:
14580
Protein Name:
Glial fibrillary acidic protein
Swissprot Id:
P03995
Protein Accession #:
NP_034407
Nucleotide Accession #:
NM_010277
Alias Symbols:
AI836096
Replacement Item:
This antibody may replace item sc-115582 from Santa Cruz Biotechnology.
Description of Target:
GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
Protein Size (# AA):
418
Molecular Weight:
46kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Gfap.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Gfap.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-Gfap (ARP54621_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Kcnma1; Myo5a; Nphp4; Ywhaz; Pou5f1; Ubc; Ncor1; Stat1; Nr2e1;
Blocking Peptide:
For anti-Gfap (ARP54621_P050) antibody is Catalog # AAP54621 (Previous Catalog # AAPP31412)
Datasheets/Manuals:
Printable datasheet for anti-Gfap (ARP54621_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...