SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP56757_P050
Price: $0.00
SKU
ARP56757_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GEMIN4 (ARP56757_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GEMIN4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: QALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLR
Concentration0.5 mg/ml
Blocking PeptideFor anti-GEMIN4 (ARP56757_P050) antibody is Catalog # AAP56757 (Previous Catalog # AAPP39614)
Sample Type Confirmation

GEMIN4 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceShpargel,K.B. (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (48), 17372-17377
Publications

CaMKK2 facilitates Golgi-associated vesicle trafficking to sustain cancer cell proliferation. Cell Death Dis. 12, 1040 (2021). 34725334

Gene SymbolGEMIN4
Gene Full NameGem (nuclear organelle) associated protein 4
Alias Symbolsp97, HC56, HCAP1, HHRF-1, NEDMCR
NCBI Gene Id50628
Protein NameGem (Nuclear organelle) associated protein 4 EMBL AAH20062.1
Description of TargetThe product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes requi
Uniprot IDQ8WUM5
Protein Accession #NP_056536
Nucleotide Accession #NM_015721
Protein Size (# AA)1058
Molecular Weight120kDa
Protein InteractionsUBC; RPA3; RPA2; RPA1; BMI1; MIB1; RN7SL1; EGFR; GEMIN4; DICER1; DDX20; SMN1; HDAC11; GLYR1; FLAD1; MORC4; vpr; SRRT; AGO2; PNKP; PIAS3; SPRY1; CALCOCO2; IQCB1; SQSTM1; UBL4A; DMPK; GEMIN2; SRP54; SRP9; RNU2-1; BARD1; RNU1-1; GEMIN5; TOP1; GRK5; SIRT7; SU
  1. What is the species homology for "GEMIN4 Antibody - N-terminal region (ARP56757_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GEMIN4 Antibody - N-terminal region (ARP56757_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GEMIN4 Antibody - N-terminal region (ARP56757_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GEMIN4 Antibody - N-terminal region (ARP56757_P050)"?

    This target may also be called "p97, HC56, HCAP1, HHRF-1, NEDMCR" in publications.

  5. What is the shipping cost for "GEMIN4 Antibody - N-terminal region (ARP56757_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GEMIN4 Antibody - N-terminal region (ARP56757_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GEMIN4 Antibody - N-terminal region (ARP56757_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "120kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GEMIN4 Antibody - N-terminal region (ARP56757_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GEMIN4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GEMIN4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GEMIN4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GEMIN4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GEMIN4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GEMIN4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GEMIN4 Antibody - N-terminal region (ARP56757_P050)
Your Rating