Catalog No: AVARP13037_P050
Price: $0.00
SKU
AVARP13037_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GDI2 (AVARP13037_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Guinea Pig, Horse, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GDI2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHF
Concentration0.5 mg/ml
Blocking PeptideFor anti-GDI2 (AVARP13037_P050) antibody is Catalog # AAP30700 (Previous Catalog # AAPP01357)
Sample Type Confirmation

GDI2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

ReferenceBruneel,A., et al., (2005) Proteomics 5 (15), 3876-3884
Gene SymbolGDI2
Gene Full NameGDP dissociation inhibitor 2
Alias SymbolsRABGDIB, HEL-S-46e
NCBI Gene Id2665
Protein NameRab GDP dissociation inhibitor beta
Description of TargetGDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements.GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements.
Uniprot IDP50395
Protein Accession #NP_001485
Nucleotide Accession #NM_001494
Protein Size (# AA)445
Molecular Weight51kDa
Protein InteractionsHUWE1; UBC; SUMO2; DUT; BAG3; IQCB1; GLRA2; FN1; SMURF1; RAB1A; RAB11B; AIP; ISG15; SIRT7; ELAVL1; Rab5c; Cdk1; Mapk13; RAB24; RAB11A; RAB9A; RAB5A; RAB4A; RAB2A; RAB8A;
  1. What is the species homology for "GDI2 Antibody - C-terminal region (AVARP13037_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Guinea Pig, Horse, Sheep".

  2. How long will it take to receive "GDI2 Antibody - C-terminal region (AVARP13037_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GDI2 Antibody - C-terminal region (AVARP13037_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GDI2 Antibody - C-terminal region (AVARP13037_P050)"?

    This target may also be called "RABGDIB, HEL-S-46e" in publications.

  5. What is the shipping cost for "GDI2 Antibody - C-terminal region (AVARP13037_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GDI2 Antibody - C-terminal region (AVARP13037_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GDI2 Antibody - C-terminal region (AVARP13037_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GDI2 Antibody - C-terminal region (AVARP13037_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GDI2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GDI2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GDI2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GDI2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GDI2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GDI2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GDI2 Antibody - C-terminal region (AVARP13037_P050)
Your Rating
We found other products you might like!