GDI2 Antibody - C-terminal region (AVARP13037_P050)

Catalog No: AVARP13037_P050

Host: Rabbit
Target Name: GDI2
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Guinea Pig, Horse, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GDI2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GDI2 (AVARP13037_P050) antibody is Catalog # AAP30700 (Previous Catalog # AAPP01357)
• Sample Type Confirmation:

  GDI2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Info

• Reference: Bruneel,A., et al., (2005) Proteomics 5 (15), 3876-3884
• Gene Symbol: GDI2
• Gene Full Name: GDP dissociation inhibitor 2
• Alias Symbols: RABGDIB, HEL-S-46e
• NCBI Gene Id: 2665
• Protein Name: Rab GDP dissociation inhibitor beta
• Description of Target: GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements.GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements.
• Uniprot ID: P50395
• Protein Accession #: NP_001485
• Nucleotide Accession #: NM_001494
• Protein Size (# AA): 445
• Molecular Weight: 51kDa
• Protein Interactions: HUWE1; UBC; SUMO2; DUT; BAG3; IQCB1; GLRA2; FN1; SMURF1; RAB1A; RAB11B; AIP; ISG15; SIRT7; ELAVL1; Rab5c; Cdk1; Mapk13; RAB24; RAB11A; RAB9A; RAB5A; RAB4A; RAB2A; RAB8A;