Search Antibody, Protein, and ELISA Kit Solutions

GDF3 Antibody - C-terminal region : FITC (ARP73869_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73869_P050 Unconjugated

ARP73869_P050-HRP Conjugated

ARP73869_P050-Biotin Conjugated

Gene Symbol:
GDF3
NCBI Gene Id:
9573
Swissprot Id:
Q9NR23
Protein Accession #:
NP_065685
Alias Symbols:
GDF3, UNQ222/PRO248,
Replacement Item:
This antibody may replace item sc-130766 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues.
Protein Size (# AA):
364
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GDF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GDF3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GDF3
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DVAKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHASLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-GDF3 (ARP73869_P050-FITC) antibody is Catalog # AAP73869
Datasheets/Manuals:
Printable datasheet for anti-GDF3 (ARP73869_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...