Size:100 ul
$319.00
In Stock
SKU
P100836_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100836_P050-FITC Conjugated

P100836_P050-HRP Conjugated

P100836_P050-Biotin Conjugated

GCM1 Antibody - N-terminal region (P100836_P050)

Catalog#: P100836_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101173, HPA011343
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GCM1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 78%; Human: 92%; Mouse: 78%; Rat: 78%
Complete computational species homology data Anti-GCM1 (P100836_P050)
Peptide Sequence Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GCM1 (P100836_P050) antibody is Catalog # AAP31192 (Previous Catalog # AAPP01935)
Datasheets/Manuals Printable datasheet for anti-GCM1 (P100836_P050) antibody
Target Reference Yu,C., et al., (2002) J. Biol. Chem. 277 (51), 50062-50068
Publications

Baczyk, D. et al. Glial cell missing-1 transcription factor is required for the differentiation of the human trophoblast. Cell Death Differ. 16, 719-27 (2009). IHC, WB, Dog, Human, Mouse, Rat 19219068

Bailey, LJ; Alahari, S; Tagliaferro, A; Post, M; Caniggia, I; Augmented trophoblast cell death in preeclampsia can proceed via ceramide-mediated necroptosis. 8, e2590 (2017). IHC, WB, Dog, Human, Mouse, Rat 28151467

Kumar, P., Luo, Y., Tudela, C., Alexander, J. M. & Mendelson, C. R. The c-Myc-regulated microRNA-17~92 (miR-17~92) and miR-106a~363 clusters target hCYP19A1 and hGCM1 to inhibit human trophoblast differentiation. Mol. Cell. Biol. 33, 1782-96 (2013). IHC, WB, Dog, Human, Mouse, Rat 23438603

Moretto Zita, M; Soncin, F; Natale, D; Pizzo, D; Parast, M; Gene Expression Profiling Reveals a Novel Regulatory Role for Sox21 Protein in Mouse Trophoblast Stem Cell Differentiation. 290, 30152-62 (2015). IHC, WB, Dog, Human, Mouse, Rat 26491013

Sivasubramaniyam, T. et al. Where polarity meets fusion: role of Par6 in trophoblast differentiation during placental development and preeclampsia. Endocrinology 154, 1296-309 (2013). IHC, WB, Dog, Human, Mouse, Rat 23341197

Gene Symbol GCM1
Official Gene Full Name Glial cells missing homolog 1 (Drosophila)
Alias Symbols GCMA, hGCMa
NCBI Gene Id 8521
Protein Name Chorion-specific transcription factor GCMa
Description of Target GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-132 D88613.1 1-132 133-2763 AB026493.1 1-2631
Swissprot Id Q9NP62
Protein Accession # NP_003634
Nucleotide Accession # NM_003643
Protein Size (# AA) 436
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GCM1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GCM1.
Protein Interactions FBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I;
  1. What is the species homology for "GCM1 Antibody - N-terminal region (P100836_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "GCM1 Antibody - N-terminal region (P100836_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GCM1 Antibody - N-terminal region (P100836_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GCM1 Antibody - N-terminal region (P100836_P050)"?

    This target may also be called "GCMA, hGCMa" in publications.

  5. What is the shipping cost for "GCM1 Antibody - N-terminal region (P100836_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GCM1 Antibody - N-terminal region (P100836_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GCM1 Antibody - N-terminal region (P100836_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GCM1 Antibody - N-terminal region (P100836_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GCM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GCM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GCM1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GCM1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GCM1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GCM1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GCM1 Antibody - N-terminal region (P100836_P050)
Your Rating
We found other products you might like!