Search Antibody, Protein, and ELISA Kit Solutions

GCM1 Antibody - N-terminal region (P100836_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100836_P050-FITC Conjugated

P100836_P050-HRP Conjugated

P100836_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Glial cells missing homolog 1 (Drosophila)
NCBI Gene Id:
Protein Name:
Chorion-specific transcription factor GCMa
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101173, HPA011343
Description of Target:
GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-132 D88613.1 1-132 133-2763 AB026493.1 1-2631
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCM1.
The immunogen is a synthetic peptide directed towards the N terminal region of human GCM1
Predicted Homology Based on Immunogen Sequence:
Dog: 78%; Human: 92%; Mouse: 78%; Rat: 78%
Complete computational species homology data:
Anti-GCM1 (P100836_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GCM1 (P100836_P050) antibody is Catalog # AAP31192 (Previous Catalog # AAPP01935)
Printable datasheet for anti-GCM1 (P100836_P050) antibody
Target Reference:
Yu,C., et al., (2002) J. Biol. Chem. 277 (51), 50062-50068

Baczyk, D. et al. Glial cell missing-1 transcription factor is required for the differentiation of the human trophoblast. Cell Death Differ. 16, 719-27 (2009). IHC, WB, Dog, Human, Mouse, Rat 19219068

Bailey, LJ; Alahari, S; Tagliaferro, A; Post, M; Caniggia, I; Augmented trophoblast cell death in preeclampsia can proceed via ceramide-mediated necroptosis. 8, e2590 (2017). IHC, WB, Dog, Human, Mouse, Rat 28151467

Kumar, P., Luo, Y., Tudela, C., Alexander, J. M. & Mendelson, C. R. The c-Myc-regulated microRNA-17~92 (miR-17~92) and miR-106a~363 clusters target hCYP19A1 and hGCM1 to inhibit human trophoblast differentiation. Mol. Cell. Biol. 33, 1782-96 (2013). IHC, WB, Dog, Human, Mouse, Rat 23438603

Moretto Zita, M; Soncin, F; Natale, D; Pizzo, D; Parast, M; Gene Expression Profiling Reveals a Novel Regulatory Role for Sox21 Protein in Mouse Trophoblast Stem Cell Differentiation. 290, 30152-62 (2015). IHC, WB, Dog, Human, Mouse, Rat 26491013

Sivasubramaniyam, T. et al. Where polarity meets fusion: role of Par6 in trophoblast differentiation during placental development and preeclampsia. Endocrinology 154, 1296-309 (2013). IHC, WB, Dog, Human, Mouse, Rat 23341197

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...