Size:100 ul
$319.00
In stock
SKU
P100836_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100836_P050-FITC Conjugated

P100836_P050-HRP Conjugated

P100836_P050-Biotin Conjugated

GCM1 Antibody - N-terminal region (P100836_P050)

Catalog#: P100836_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-101173, HPA011343
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GCM1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 78%; Human: 92%; Mouse: 78%; Rat: 78%
Complete computational species homology dataAnti-GCM1 (P100836_P050)
Peptide SequenceSynthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-GCM1 (P100836_P050) antibody is Catalog # AAP31192 (Previous Catalog # AAPP01935)
Datasheets/ManualsPrintable datasheet for anti-GCM1 (P100836_P050) antibody
Target ReferenceYu,C., et al., (2002) J. Biol. Chem. 277 (51), 50062-50068
Publications

Baczyk, D. et al. Glial cell missing-1 transcription factor is required for the differentiation of the human trophoblast. Cell Death Differ. 16, 719-27 (2009). IHC, WB, Dog, Human, Mouse, Rat 19219068

Bailey, LJ; Alahari, S; Tagliaferro, A; Post, M; Caniggia, I; Augmented trophoblast cell death in preeclampsia can proceed via ceramide-mediated necroptosis. 8, e2590 (2017). IHC, WB, Dog, Human, Mouse, Rat 28151467

Kumar, P., Luo, Y., Tudela, C., Alexander, J. M. & Mendelson, C. R. The c-Myc-regulated microRNA-17~92 (miR-17~92) and miR-106a~363 clusters target hCYP19A1 and hGCM1 to inhibit human trophoblast differentiation. Mol. Cell. Biol. 33, 1782-96 (2013). IHC, WB, Dog, Human, Mouse, Rat 23438603

Moretto Zita, M; Soncin, F; Natale, D; Pizzo, D; Parast, M; Gene Expression Profiling Reveals a Novel Regulatory Role for Sox21 Protein in Mouse Trophoblast Stem Cell Differentiation. 290, 30152-62 (2015). IHC, WB, Dog, Human, Mouse, Rat 26491013

Sivasubramaniyam, T. et al. Where polarity meets fusion: role of Par6 in trophoblast differentiation during placental development and preeclampsia. Endocrinology 154, 1296-309 (2013). IHC, WB, Dog, Human, Mouse, Rat 23341197

Gene SymbolGCM1
Official Gene Full NameGlial cells missing homolog 1 (Drosophila)
Alias SymbolsGCMA, hGCMa
NCBI Gene Id8521
Protein NameChorion-specific transcription factor GCMa
Description of TargetGCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-132 D88613.1 1-132 133-2763 AB026493.1 1-2631
Swissprot IdQ9NP62
Protein Accession #NP_003634
Nucleotide Accession #NM_003643
Protein Size (# AA)436
Molecular Weight49kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express GCM1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express GCM1.
Protein InteractionsFBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I;
Write Your Own Review
You're reviewing:GCM1 Antibody - N-terminal region (P100836_P050)
Your Rating
Aviva Live Chat
Aviva Pathways
Aviva Validation Data
Aviva HIS tag Deal