Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP36863_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36863_P050-FITC Conjugated

ARP36863_P050-HRP Conjugated

ARP36863_P050-Biotin Conjugated

Gcm1 Antibody - N-terminal region (ARP36863_P050)

Catalog#: ARP36863_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101173 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse Gcm1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 86%; Mouse: 100%; Rat: 93%; Zebrafish: 86%
Complete computational species homology data Anti-Gcm1 (ARP36863_P050)
Peptide Sequence Synthetic peptide located within the following region: KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Gcm1 (ARP36863_P050) antibody is Catalog # AAP36863 (Previous Catalog # AAPY00614)
Datasheets/Manuals Printable datasheet for anti-Gcm1 (ARP36863_P050) antibody
Publications

Zhang, M; Muralimanoharan, S; Wortman, AC; Mendelson, CR; Primate-specific miR-515 family members inhibit key genes in human trophoblast differentiation and are upregulated in preeclampsia. , (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 27791094

Gene Symbol Gcm1
Official Gene Full Name Glial cells missing homolog 1 (Drosophila)
Alias Symbols GCMa, Gcm-rs2, Gcm1-rs1, glide
NCBI Gene Id 14531
Protein Name Chorion-specific transcription factor GCMa
Description of Target Transcription factor that is necessary for placental development
Swissprot Id P70348
Protein Accession # NP_032129
Nucleotide Accession # NM_008103
Protein Size (# AA) 436
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Gcm1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Gcm1.
Write Your Own Review
You're reviewing:Gcm1 Antibody - N-terminal region (ARP36863_P050)
Your Rating