Search Antibody, Protein, and ELISA Kit Solutions

Gcm1 antibody - N-terminal region (ARP36863_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36863_P050-FITC Conjugated

ARP36863_P050-HRP Conjugated

ARP36863_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Glial cells missing homolog 1 (Drosophila)
Protein Name:
Chorion-specific transcription factor GCMa
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
GCMa, Gcm-rs2, Gcm1-rs1, glide
Replacement Item:
This antibody may replace item sc-101173 from Santa Cruz Biotechnology.
Description of Target:
Transcription factor that is necessary for placental development
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Gcm1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Gcm1.
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Gcm1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 86%; Mouse: 100%; Rat: 93%; Zebrafish: 86%
Complete computational species homology data:
Anti-Gcm1 (ARP36863_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Gcm1 (ARP36863_P050) antibody is Catalog # AAP36863 (Previous Catalog # AAPY00614)
Printable datasheet for anti-Gcm1 (ARP36863_P050) antibody

Zhang, M; Muralimanoharan, S; Wortman, AC; Mendelson, CR; Primate-specific miR-515 family members inhibit key genes in human trophoblast differentiation and are upregulated in preeclampsia. , (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 27791094

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...