GCM1 Antibody - C-terminal region (P100837_P050)

Catalog No: P100837_P050

WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Publications:

  Drewlo, S., Czikk, M., Baczyk, D., Lye, S. & Kingdom, J. Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi. Hum. Reprod. 26, 1025-34 (2011). 21406447

  More...

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GCM1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 90%; Horse: 92%; Human: 100%; Rabbit: 81%
• Peptide Sequence: Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GCM1 (P100837_P050) antibody is Catalog # AAP31193 (Previous Catalog # AAPP01936)

Target Info

• Reference: Chuang,H.C., et al., (2006) (er) Nucleic Acids Res. 34 (5), 1459-1469
• Gene Symbol: GCM1
• Gene Full Name: Glial cells missing homolog 1 (Drosophila)
• Alias Symbols: GCMA, hGCMa
• NCBI Gene Id: 8521
• Protein Name: Chorion-specific transcription factor GCMa
• Description of Target: GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
• Uniprot ID: Q9NP62
• Protein Accession #: NP_003634
• Nucleotide Accession #: NM_003643
• Protein Size (# AA): 436
• Molecular Weight: 49kDa
• Protein Interactions: FBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I;