Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
P100837_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100837_P050-FITC Conjugated

P100837_P050-HRP Conjugated

P100837_P050-Biotin Conjugated

GCM1 Antibody - C-terminal region (P100837_P050)

Rating:
80% of 100
Catalog#: P100837_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Horse, Human, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101173 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GCM1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 90%; Horse: 92%; Human: 100%; Rabbit: 81%
Complete computational species homology data Anti-GCM1 (P100837_P050)
Peptide Sequence Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GCM1 (P100837_P050) antibody is Catalog # AAP31193 (Previous Catalog # AAPP01936)
Datasheets/Manuals Printable datasheet for anti-GCM1 (P100837_P050) antibody
Target Reference Chuang,H.C., et al., (2006) (er) Nucleic Acids Res. 34 (5), 1459-1469
Publications

Drewlo, S., Czikk, M., Baczyk, D., Lye, S. & Kingdom, J. Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi. Hum. Reprod. 26, 1025-34 (2011). WB, Dog, Horse, Human, Rabbit 21406447

Gene Symbol GCM1
Official Gene Full Name Glial cells missing homolog 1 (Drosophila)
Alias Symbols GCMA, hGCMa
NCBI Gene Id 8521
Protein Name Chorion-specific transcription factor GCMa
Description of Target GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
Swissprot Id Q9NP62
Protein Accession # NP_003634
Nucleotide Accession # NM_003643
Protein Size (# AA) 436
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GCM1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GCM1.
Protein Interactions FBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I;
Write Your Own Review
You're reviewing:GCM1 Antibody - C-terminal region (P100837_P050)
Your Rating