Search Antibody, Protein, and ELISA Kit Solutions

GCM1 Antibody - C-terminal region (P100837_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100837_P050-FITC Conjugated

P100837_P050-HRP Conjugated

P100837_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Horse, Human, Rabbit
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Glial cells missing homolog 1 (Drosophila)
NCBI Gene Id:
Protein Name:
Chorion-specific transcription factor GCMa
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101173 from Santa Cruz Biotechnology.
Description of Target:
GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCM1.
The immunogen is a synthetic peptide directed towards the C terminal region of human GCM1
Predicted Homology Based on Immunogen Sequence:
Dog: 90%; Horse: 92%; Human: 100%; Rabbit: 81%
Complete computational species homology data:
Anti-GCM1 (P100837_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GCM1 (P100837_P050) antibody is Catalog # AAP31193 (Previous Catalog # AAPP01936)
Printable datasheet for anti-GCM1 (P100837_P050) antibody
Target Reference:
Chuang,H.C., et al., (2006) (er) Nucleic Acids Res. 34 (5), 1459-1469

Drewlo, S., Czikk, M., Baczyk, D., Lye, S. & Kingdom, J. Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi. Hum. Reprod. 26, 1025-34 (2011). WB, Dog, Horse, Human, Rabbit 21406447

Product Reviews

Average Rating:
2 reviews
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

2 Item(s)

50/02/2019 01:27
  • Overall Experience:
  • Quality:
BeWo Cells, Trophoblast Cells, Human Placenta in WB

Submitted by:
Hamid Reza Kohan-Ghadr
Wayne State University, School of Medicine


1. Sample type/lane description: BeWo cells; Trophoblast (HTR-8/Svneo) cells; Human Term Placenta.
Lane 1: 20ug BeWo cell lysate
Lane 2: 20ug Trophoblast (HTR-8/Svneo) cell lysate
Lane 3: 20ug Human Term Placenta lysate

2. Sample preparation method: The protein extraction buffer contains (SDS 1%, EDTA 5mM, EGTA 5mM, DTT 50mM) supplemented by protease/phosphatase inhibitor cocktail. After adding extraction buffer, tissues were disrupted and homogenized using homogenizer and heated to 95°C. Samples were centrifuged and the supernatants were collected and kept at -80°C until use.

3. Primary antibody dilution: 1:3000

4. Protocol:
Appropriate volume of samples containing 20µg of total protein were running on 10% TGX stain-free acrylamide gel for about 2 hours on 100V. Proteins were transferred on PVDF membrane using a semi-dry Turbo-Blot system. Blot was incubated for 1 hour with blocking 5% reagent in TBST (0.5% Tween20) following overnight incubation with primary antibody (1:3000 (0.3µg/ml) in TBS). Next day, blot was washed 3X5min with TBST (0.5% Tween20) then was incubated with secondary antibody for 1 hour. Thereafter, bolt was washed 3X10min with TBST (0.5% Tween20) and incubated with ""Western Lightning ECL Pro Chemiluminescence substrate; PerkinElmer #NEL120001EA"" for 5min. ChemiDoc MP imaging system was used for image acquisition.

Show more comments (-2) Hide comments
50/02/2019 01:27
  • Overall Experience:
  • Quality:
BeWo Cells, Trophoblast Cells, Human Placenta in WB

Submitted by:
Hamid Reza Kohan-Ghadr
Wayne State University, School of Medicine


1. Sample type/lane description: BeWo cells; Trophoblast (HTR-8/Svneo) cells; Human Term Placenta.
Lane 1: 20ug BeWo cell lysate
Lane 2: 20ug Trophoblast (HTR-8/Svneo) cell lysate
Lane 3: 20ug Human Term Placenta lysate

2. Sample preparation method: The protein extraction buffer contains (SDS 1%, EDTA 5mM, EGTA 5mM, DTT 50mM) supplemented by protease/phosphatase inhibitor cocktail. After adding extraction buffer, tissues were disrupted and homogenized using homogenizer and heated to 95°C. Samples were centrifuged and the supernatants were collected and kept at -80°C until use.

3. Primary antibody dilution: 1:3000

4. Protocol:
Appropriate volume of samples containing 20µg of total protein were running on 10% TGX stain-free acrylamide gel for about 2 hours on 100V. Proteins were transferred on PVDF membrane using a semi-dry Turbo-Blot system. Blot was incubated for 1 hour with blocking 5% reagent in TBST (0.5% Tween20) following overnight incubation with primary antibody (1:3000 (0.3µg/ml) in TBS). Next day, blot was washed 3X5min with TBST (0.5% Tween20) then was incubated with secondary antibody for 1 hour. Thereafter, bolt was washed 3X10min with TBST (0.5% Tween20) and incubated with ""Western Lightning ECL Pro Chemiluminescence substrate; PerkinElmer #NEL120001EA"" for 5min. ChemiDoc MP imaging system was used for image acquisition.

Show more comments (-2) Hide comments

2 Item(s)

What kind of abuse are you reporting?
    Please, wait...