Search Antibody, Protein, and ELISA Kit Solutions

GCM1 antibody - C-terminal region (P100837_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100837_P050-FITC Conjugated

P100837_P050-HRP Conjugated

P100837_P050-Biotin Conjugated

Gene Symbol:
GCM1
NCBI Gene Id:
8521
Official Gene Full Name:
Glial cells missing homolog 1 (Drosophila)
Protein Name:
Chorion-specific transcription factor GCMa
Swissprot Id:
Q9NP62
Protein Accession #:
NP_003634
Nucleotide Accession #:
NM_003643
Alias Symbols:
GCMA, hGCMa
Replacement Item:
This antibody may replace item sc-101173 from Santa Cruz Biotechnology.
Description of Target:
GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
Protein Size (# AA):
436
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCM1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human GCM1
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 90%; Horse: 92%; Human: 100%; Rabbit: 81%
Complete computational species homology data:
Anti-GCM1 (P100837_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I;
Blocking Peptide:
For anti-GCM1 (P100837_P050) antibody is Catalog # AAP31193 (Previous Catalog # AAPP01936)
Datasheets/Manuals:
Printable datasheet for anti-GCM1 (P100837_P050) antibody
Target Reference:
Chuang,H.C., et al., (2006) (er) Nucleic Acids Res. 34 (5), 1459-1469
Publications:

Drewlo, S., Czikk, M., Baczyk, D., Lye, S. & Kingdom, J. Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi. Hum. Reprod. 26, 1025-34 (2011). WB, Dog, Horse, Human, Rabbit 21406447

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...