Catalog No: P100837_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GCM1 (P100837_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GCM1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 90%; Horse: 92%; Human: 100%; Rabbit: 81%
Peptide SequenceSynthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
Concentration0.5 mg/ml
Blocking PeptideFor anti-GCM1 (P100837_P050) antibody is Catalog # AAP31193 (Previous Catalog # AAPP01936)
ReferenceChuang,H.C., et al., (2006) (er) Nucleic Acids Res. 34 (5), 1459-1469

Drewlo, S., Czikk, M., Baczyk, D., Lye, S. & Kingdom, J. Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi. Hum. Reprod. 26, 1025-34 (2011). 21406447

Gene SymbolGCM1
Gene Full NameGlial cells missing homolog 1 (Drosophila)
Alias SymbolsGCMA, hGCMa
NCBI Gene Id8521
Protein NameChorion-specific transcription factor GCMa
Description of TargetGCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
Uniprot IDQ9NP62
Protein Accession #NP_003634
Nucleotide Accession #NM_003643
Protein Size (# AA)436
Molecular Weight49kDa
Protein InteractionsFBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I;
  1. What is the species homology for "GCM1 Antibody - C-terminal region (P100837_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Horse, Rabbit".

  2. How long will it take to receive "GCM1 Antibody - C-terminal region (P100837_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GCM1 Antibody - C-terminal region (P100837_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GCM1 Antibody - C-terminal region (P100837_P050)"?

    This target may also be called "GCMA, hGCMa" in publications.

  5. What is the shipping cost for "GCM1 Antibody - C-terminal region (P100837_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GCM1 Antibody - C-terminal region (P100837_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GCM1 Antibody - C-terminal region (P100837_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GCM1 Antibody - C-terminal region (P100837_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GCM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GCM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GCM1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GCM1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GCM1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GCM1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GCM1 Antibody - C-terminal region (P100837_P050)
Your Rating
We found other products you might like!