GCM1 Antibody - C-terminal region : FITC (P100837_P050-FITC)

Catalog No: P100837_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GCM1
• Predicted Homology Based on Immunogen Sequence: Dog: 90%; Horse: 92%; Human: 100%; Rabbit: 81%
• Peptide Sequence: Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GCM1 (P100837_P050-FITC) antibody is Catalog # AAP31193 (Previous Catalog # AAPP01936)
• Reference: Chuang,H.C., et al., (2006) (er) Nucleic Acids Res. 34 (5), 1459-1469
• Publications:

  Drewlo, S., Czikk, M., Baczyk, D., Lye, S. & Kingdom, J. Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi. Hum. Reprod. 26, 1025-34 (2011). WB, Dog, Horse, Human, Rabbit 21406447

Target Info

• Gene Symbol: GCM1
• Gene Full Name: Glial cells missing homolog 1 (Drosophila)
• Alias Symbols: GCMA, hGCMa
• NCBI Gene Id: 8521
• Protein Name: Chorion-specific transcription factor GCMa
• Description of Target: GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
• Uniprot ID: Q9NP62
• Protein Accession #: NP_003634
• Nucleotide Accession #: NM_003643
• Protein Size (# AA): 436
• Molecular Weight: 49kDa
• Protein Interactions: FBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I;