Size:100 ul
$319.00
In stock
SKU
ARP54576_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54576_P050-FITC Conjugated

ARP54576_P050-HRP Conjugated

ARP54576_P050-Biotin Conjugated

GCLC Antibody - N-terminal region (ARP54576_P050)

Catalog#: ARP54576_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-115522 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GCLC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology dataAnti-GCLC (ARP54576_P050)
Peptide SequenceSynthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-GCLC (ARP54576_P050) antibody is Catalog # AAP54576 (Previous Catalog # AAPP31360)
Datasheets/ManualsPrintable datasheet for anti-GCLC (ARP54576_P050) antibody
Target ReferenceJonsson,L.S., (2008) Int Arch Occup Environ Health 81 (7), 913-919
Publications

Tomasi, M. L. et al. Molecular mechanisms of lipopolysaccharide-mediated inhibition of glutathione synthesis in mice. Free Radic. Biol. Med. 68, 148-58 (2014). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24296246

Gene SymbolGCLC
Official Gene Full NameGlutamate-cysteine ligase, catalytic subunit
Alias SymbolsGCS, GLCL, GLCLC, GCL
NCBI Gene Id2729
Protein NameGlutamate-cysteine ligase EMBL BAE97618.1
Description of TargetGlutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene encoding the catalytic subunit encodes a protein of 367 amino acids with a calculated molecular weight of 72.773 kDa and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP48506
Protein Accession #NP_001489
Nucleotide Accession #NM_001498
Protein Size (# AA)637
Molecular Weight73kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express GCLC.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express GCLC.
Protein InteractionsUBC; PPID; GCLM; CCL22; PAXIP1; ELAVL1;
Write Your Own Review
You're reviewing:GCLC Antibody - N-terminal region (ARP54576_P050)
Your Rating
Aviva Pathways
Aviva Tissue Tool
Assay Development
Free Microscope