Search Antibody, Protein, and ELISA Kit Solutions

GCLC Antibody - middle region (ARP89333_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
GCLC
Official Gene Full Name:
glutamate-cysteine ligase, catalytic subunit
NCBI Gene Id:
14629
Protein Name:
Glclc, GLCL-H, Ggcs-hs, D9Wsu168e
Swissprot Id:
P97494
Protein Accession #:
NP_034425.1
Nucleotide Accession #:
NM_010295.2
Alias Symbols:
Glclc, GLCL-H, Ggcs-hs, D9Wsu168e
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
637
Molecular Weight:
70 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCLC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCLC.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse GCLC
Peptide Sequence:
Synthetic peptide located within the following region: HFENIQSTNWQTMRFKPPPPNSDIGWRVEFRPMEVQLTDFENSAYVVFVV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GCLC (ARP89333_P050) antibody is Catalog # AAP89333
Datasheets/Manuals:
Printable datasheet for anti-GCLC (ARP89333_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...