GCKR Antibody - N-terminal region (ARP74540_P050)

Catalog No: ARP74540_P050

Host: Rabbit
Target Name: GCKR
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCKR
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: VIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GCKR (ARP74540_P050) antibody is Catalog # AAP74540

Target Info

• Gene Symbol: GCKR
• Alias Symbols: GKRP, FGQTL5
• NCBI Gene Id: 2646
• Description of Target: This gene encodes a protein belonging to the GCKR subfamily of the SIS (Sugar ISomerase) family of proteins. The gene product is a regulatory protein that inhibits glucokinase in liver and pancreatic islet cells by binding non-covalently to form an inactive complex with the enzyme. This gene is considered a susceptibility gene candidate for a form of maturity-onset diabetes of the young (MODY).
• Uniprot ID: Q14397
• Protein Accession #: NP_001477
• Protein Size (# AA): 625
• Molecular Weight: 68kDa
• Protein Interactions: CDKN1A; UBC; TRAF2; GCK;