GCK Antibody - N-terminal region (ARP61473_P050)

Catalog No: ARP61473_P050

WB Suggested Anti-GCK Antibody
Titration: 1.0 ug/ml
Positive Control: COLO205 Whole Cell

Lanes:
1: 50 ug HEP3B lysate, 2: 50 ug HEP3B lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:1000
Gene Name:
GCK
Submitted by:
Received from annonymous

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%
• Peptide Sequence: Synthetic peptide located within the following region: RVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GCK (ARP61473_P050) antibody is Catalog # AAP61473 (Previous Catalog # AAPP47613)
• Publications:

  Anti-diabetes effect of chronic intermittent hypobaric hypoxia through improving liver insulin resistance in diabetic rats. Life Sci. 150, 1-7 (2016). 26883978

Target Info

• Gene Symbol: GCK
• Gene Full Name: Glucokinase (hexokinase 4)
• Alias Symbols: GK, GLK, HK4, HHF3, HKIV, HXKP, LGLK, MODY2, PNDM1, FGQTL3
• NCBI Gene Id: 2645
• Protein Name: Glucokinase
• Description of Target: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. Alternative splicing of this gene results in three tissue-specific forms of glucokinase, one found in pancreatic islet beta cells and two found in liver. The protein localizes to the outer membrane of mitochondria. In contrast to other forms of hexokinase, this enzyme is not inhibited by its product glucose-6-phosphate but remains active while glucose is abundant. Mutations in this gene have been associated with non-insulin dependent diabetes mellitus (NIDDM), maturity onset diabetes of the young, type 2 (MODY2) and persistent hyperinsulinemic hypoglycemia of infancy (PHHI).
• Uniprot ID: P35557-3
• Protein Accession #: NP_277043
• Nucleotide Accession #: NM_033508
• Protein Size (# AA): 464
• Molecular Weight: 51kDa
• Protein Interactions: PCNA; GCKR; INS; PFKFB2; MIG1;