Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GCK Antibody - N-terminal region (ARP61473_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61473_P050-FITC Conjugated

ARP61473_P050-HRP Conjugated

ARP61473_P050-Biotin Conjugated

Gene Symbol:
GCK
Official Gene Full Name:
Glucokinase (hexokinase 4)
NCBI Gene Id:
2645
Protein Name:
Glucokinase
Swissprot Id:
P35557-3
Protein Accession #:
NP_277043
Nucleotide Accession #:
NM_033508
Alias Symbols:
FGQTL3, GK, GLK, HHF3, HK4, HKIV, HXKP, MODY2, LGLK
Replacement Item:
This antibody may replace item sc-130765 from Santa Cruz Biotechnology.
Description of Target:
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. Alternative splicing of this gene results in three tissue-specific forms of glucokinase, one found in pancreatic islet beta cells and two found in liver. The protein localizes to the outer membrane of mitochondria. In contrast to other forms of hexokinase, this enzyme is not inhibited by its product glucose-6-phosphate but remains active while glucose is abundant. Mutations in this gene have been associated with non-insulin dependent diabetes mellitus (NIDDM), maturity onset diabetes of the young, type 2 (MODY2) and persistent hyperinsulinemic hypoglycemia of infancy (PHHI).
Protein Size (# AA):
464
Molecular Weight:
51kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCK.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-GCK (ARP61473_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PCNA; GCKR; INS; PFKFB2; MIG1;
Blocking Peptide:
For anti-GCK (ARP61473_P050) antibody is Catalog # AAP61473 (Previous Catalog # AAPP47613)
Datasheets/Manuals:
Printable datasheet for anti-GCK (ARP61473_P050) antibody
Publications:

Tian, YM; Liu, Y; Wang, S; Dong, Y; Su, T; Ma, HJ; Zhang, Y; Anti-diabetes effect of chronic intermittent hypobaric hypoxia through improving liver insulin resistance in diabetic rats. 150, 1-7 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 26883978

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...