Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP61473_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP61473_P050-FITC Conjugated

ARP61473_P050-HRP Conjugated

ARP61473_P050-Biotin Conjugated

GCK Antibody - N-terminal region (ARP61473_P050)

Catalog#: ARP61473_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130765 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Complete computational species homology data Anti-GCK (ARP61473_P050)
Peptide Sequence Synthetic peptide located within the following region: RVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GCK (ARP61473_P050) antibody is Catalog # AAP61473 (Previous Catalog # AAPP47613)
Datasheets/Manuals Printable datasheet for anti-GCK (ARP61473_P050) antibody
Publications

Tian, YM; Liu, Y; Wang, S; Dong, Y; Su, T; Ma, HJ; Zhang, Y; Anti-diabetes effect of chronic intermittent hypobaric hypoxia through improving liver insulin resistance in diabetic rats. 150, 1-7 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 26883978

Gene Symbol GCK
Official Gene Full Name Glucokinase (hexokinase 4)
Alias Symbols FGQTL3, GK, GLK, HHF3, HK4, HKIV, HXKP, MODY2, LGLK
NCBI Gene Id 2645
Protein Name Glucokinase
Description of Target Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. Alternative splicing of this gene results in three tissue-specific forms of glucokinase, one found in pancreatic islet beta cells and two found in liver. The protein localizes to the outer membrane of mitochondria. In contrast to other forms of hexokinase, this enzyme is not inhibited by its product glucose-6-phosphate but remains active while glucose is abundant. Mutations in this gene have been associated with non-insulin dependent diabetes mellitus (NIDDM), maturity onset diabetes of the young, type 2 (MODY2) and persistent hyperinsulinemic hypoglycemia of infancy (PHHI).
Swissprot Id P35557-3
Protein Accession # NP_277043
Nucleotide Accession # NM_033508
Protein Size (# AA) 464
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GCK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GCK.
Protein Interactions PCNA; GCKR; INS; PFKFB2; MIG1;
Write Your Own Review
You're reviewing:GCK Antibody - N-terminal region (ARP61473_P050)
Your Rating