Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any help please email info@avivasysbio.com

Catalog No: ARP43574_P050
Price: $0.00
SKU
ARP43574_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GCHFR (ARP43574_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GCHFR
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD
Concentration0.5 mg/ml
Blocking PeptideFor anti-GCHFR (ARP43574_P050) antibody is Catalog # AAP43574 (Previous Catalog # AAPP25018)
ReferenceOhta,E., (2006) Arch. Neurol. 63 (11), 1605-1610
Gene SymbolGCHFR
Gene Full NameGTP cyclohydrolase I feedback regulator
Alias SymbolsP35, GFRP, HsT16933
NCBI Gene Id2644
Protein NameGTP cyclohydrolase 1 feedback regulatory protein
Description of TargetGTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.
Uniprot IDP30047
Protein Accession #NP_005249
Nucleotide Accession #NM_005258
Protein Size (# AA)84
Molecular Weight10kDa
Protein InteractionsGCH1; MYC; EBNA-LP; GCHFR;
  1. What is the species homology for "GCHFR Antibody - N-terminal region (ARP43574_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GCHFR Antibody - N-terminal region (ARP43574_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GCHFR Antibody - N-terminal region (ARP43574_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GCHFR Antibody - N-terminal region (ARP43574_P050)"?

    This target may also be called "P35, GFRP, HsT16933" in publications.

  5. What is the shipping cost for "GCHFR Antibody - N-terminal region (ARP43574_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GCHFR Antibody - N-terminal region (ARP43574_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GCHFR Antibody - N-terminal region (ARP43574_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "10kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GCHFR Antibody - N-terminal region (ARP43574_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GCHFR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GCHFR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GCHFR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GCHFR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GCHFR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GCHFR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GCHFR Antibody - N-terminal region (ARP43574_P050)
Your Rating