Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP88307_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

GCHFR Antibody - middle region (ARP88307_P050)

Catalog#: ARP88307_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GCHFR
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: PTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GCHFR (ARP88307_P050) antibody is Catalog # AAP88307
Datasheets/Manuals Printable datasheet for anti-GCHFR (ARP88307_P050) antibody
Gene Symbol GCHFR
Official Gene Full Name GTP cyclohydrolase I feedback regulator
Alias Symbols P35, GFRP, HsT16933
NCBI Gene Id 2644
Protein Name GTP cyclohydrolase 1 feedback regulatory protein
Description of Target GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.
Swissprot Id P30047
Protein Accession # NP_005249.1
Nucleotide Accession # NM_005258.2
Protein Size (# AA) 84
Molecular Weight 9 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GCHFR.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GCHFR.
  1. What is the species homology for "GCHFR Antibody - middle region (ARP88307_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "GCHFR Antibody - middle region (ARP88307_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "GCHFR Antibody - middle region (ARP88307_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GCHFR Antibody - middle region (ARP88307_P050)"?

    This target may also be called "P35, GFRP, HsT16933" in publications.

  5. What is the shipping cost for "GCHFR Antibody - middle region (ARP88307_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GCHFR Antibody - middle region (ARP88307_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GCHFR Antibody - middle region (ARP88307_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "9 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GCHFR Antibody - middle region (ARP88307_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GCHFR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GCHFR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GCHFR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GCHFR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GCHFR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GCHFR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GCHFR Antibody - middle region (ARP88307_P050)
Your Rating