Search Antibody, Protein, and ELISA Kit Solutions

GCHFR Antibody - middle region (ARP88307_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
GCHFR
Official Gene Full Name:
GTP cyclohydrolase I feedback regulator
NCBI Gene Id:
2644
Protein Name:
GTP cyclohydrolase 1 feedback regulatory protein
Swissprot Id:
P30047
Protein Accession #:
NP_005249.1
Nucleotide Accession #:
NM_005258.2
Alias Symbols:
P35, GFRP, HsT16933
Description of Target:
GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.
Protein Size (# AA):
84
Molecular Weight:
9 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCHFR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCHFR.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GCHFR
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GCHFR (ARP88307_P050) antibody is Catalog # AAP88307
Datasheets/Manuals:
Printable datasheet for anti-GCHFR (ARP88307_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...