GCG Recombinant Protein (Human) (OPCA04088)

Catalog No: OPCA04088

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
• Protein Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 53-89 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Glucagon gene expression in vertebrate brain.Drucker D.J., Asa S.J. Biol. Chem. 263:13475-13478(1988)

Target Info

• Gene Symbol: GCG
• Gene Full Name: glucagon
• Alias Symbols: glicentin-related polypeptide;GLP1;GLP-1;GLP2;glucagon-like peptide 1;glucagon-like peptide 2;GRPP;preproglucagon;pro-glucagon.
• NCBI Gene Id: 2641
• Protein Name: Glucagon
• Description of Target: Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.
• Uniprot ID: P01275
• Protein Accession #: NP_002045
• Nucleotide Accession #: NM_002054
• Protein Size (# AA): Recombinant
• Molecular Weight: 6.4 kDa