GBA2 Antibody - middle region (ARP57499_P050)

Catalog No: ARP57499_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: GBA2
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GBA2
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: GTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GBA2 (ARP57499_P050) antibody is Catalog # AAP57499

Target Info

• Gene Symbol: GBA2
• Gene Full Name: glucosylceramidase beta 2
• Alias Symbols: AD035, SPG46, NLGase
• NCBI Gene Id: 57704
• Protein Name: Non-lysosomal glucosylceramidase
• Description of Target: This gene encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides as endogenous compounds. Studies to determine subcellular localization of this protein in the liver indicated that the enzyme was mainly enriched in the microsomal fraction where it appeared to be confined to the endoplasmic reticulum. This putative transmembrane protein is thought to play a role in carbohydrate transport and metabolism.
• Uniprot ID: Q9HCG7
• Protein Accession #: NP_065995
• Nucleotide Accession #: NM_020944.3
• Protein Size (# AA): 927
• Molecular Weight: 105 kDa
• Protein Interactions: APP;