GATM Antibody - middle region (ARP48553_P050)

Catalog No: ARP48553_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: GATM
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target: GATM
Positive control (+): Human liver (LI)
Negative control (-): Human lung (LU)
Antibody concentration: 1ug/ml

Rabbit Anti-GATM antibody
Catalog Number: ARP48553
Formalin Fixed Paraffin Embedded Tissue: Human Kidney
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GATM
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GATM (ARP48553_P050) antibody is Catalog # AAP48553 (Previous Catalog # AAPP35632)
• Sample Type Confirmation:

  GATM is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

Target Info

• Reference: Kawasaki,H., (2006) Neurology 67 (9), 1713-1714
• Gene Symbol: GATM
• Gene Full Name: Glycine amidinotransferase (L-arginine:glycine amidinotransferase)
• Alias Symbols: AT, AGAT, CCDS3, FRTS1
• NCBI Gene Id: 2628
• Protein Name: Glycine amidinotransferase, mitochondrial
• Description of Target: GATM is a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P50440
• Protein Accession #: NP_001473
• Nucleotide Accession #: NM_001482
• Protein Size (# AA): 423
• Molecular Weight: 48 kDa
• Protein Interactions: CYP2E1; Gatm;