GATA4 Antibody - N-terminal region (ARP38100_P050)

Catalog No: ARP38100_P050

WB Suggested Anti-GATA4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Lanes:
1: 25 ug mouse tumor + shRNA1, 2: 25 ug mouse tumor + shRNA2, 3: 25 ug mouse tumor + shRNA3 4: 25 ug mouse tumor lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:3500
Gene Name:
GATA4
Submitted by:
Dr. Jonahan Kurie, UT MD Anderson Cancer center

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GATA4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GATA4 (ARP38100_P050) antibody is Catalog # AAP38100 (Previous Catalog # AAPP20274)
• Reference: Anttonen,M., et al., (2005) J. Clin. Endocrinol. Metab. 90 (12), 6529-6535

Target Info

• Gene Symbol: GATA4
• Gene Full Name: GATA binding protein 4
• Alias Symbols: TOF, ASD2, VSD1, TACHD
• NCBI Gene Id: 2626
• Protein Name: Transcription factor GATA-4
• Description of Target: GATA4 is a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. GATA4is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects.This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects.
• Uniprot ID: Q5IFM8
• Protein Accession #: NP_002043
• Nucleotide Accession #: NM_002052
• Protein Size (# AA): 442
• Molecular Weight: 45kDa
• Protein Interactions: JARID2; NKX2-5; ZFPM2; KDM6A; EZH2; EZH1; SUZ12; SP1; HDAC2; Ep300; Cdk9; ZBTB3; ALX4; ID3; ID2; ID1; PIAS1; NFATC4; MED1; HAND2; MAPK3; TBX5; CRIP2; MEF2C; SRF; NR5A1; FOS; MAPK1; MDC1;