Size:100 ul
$249.00
In stock
SKU
ARP31855_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31855_T100-FITC Conjugated

ARP31855_T100-HRP Conjugated

ARP31855_T100-Biotin Conjugated

GATA2 Antibody - N-terminal region (ARP31855_T100)

Rating:
80% of 100
Catalog#: ARP31855_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-1235 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GATA2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-GATA2 (ARP31855_T100)
Peptide Sequence Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GATA2 (ARP31855_T100) antibody is Catalog # AAP31855 (Previous Catalog # AAPP02650)
Datasheets/Manuals Printable datasheet for anti-GATA2 (ARP31855_T100) antibody
Sample Type Confirmation

GATA2 is strongly supported by BioGPS gene expression data to be expressed in K562

Target Reference Tsuzuki, S., et al., (2004) Mol. Cell. Biol. 24 (15), 6824-6836
Publications

Fujiwara, T. et al. Gene expression profiling identifies HOXB4 as a direct downstream target of GATA-2 in human CD34+ hematopoietic cells. PLoS One 7, e40959 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23028422

Huang, Y.-J. et al. The functional IGFBP7 promoter -418G>A polymorphism and risk of head and neck cancer. Mutat. Res. 702, 32-9 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20599521

Jack, B. H. A. & Crossley, M. GATA proteins work together with friend of GATA (FOG) and C-terminal binding protein (CTBP) co-regulators to control adipogenesis. J. Biol. Chem. 285, 32405-14 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20705609

Mammoto, A. et al. A mechanosensitive transcriptional mechanism that controls angiogenesis. Nature 457, 1103-8 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19242469

Wang, F. et al. A regulatory circuit comprising GATA1/2 switch and microRNA-27a/24 promotes erythropoiesis. Nucleic Acids Res. 42, 442-57 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24049083

Gene Symbol GATA2
Official Gene Full Name GATA binding protein 2
Alias Symbols DCML, NFE1B, MONOMAC
NCBI Gene Id 2624
Protein Name Endothelial transcription factor GATA-2
Description of Target The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.
Swissprot Id P23769
Protein Accession # NP_116027
Nucleotide Accession # NM_032638
Protein Size (# AA) 480
Molecular Weight 50kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GATA2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GATA2.
Protein Interactions NOTCH2NL; KRTAP10-3; KRTAP10-9; KRT40; PRR20A; ADAMTSL4; TRAF1; PSMA3; MDFI; GOLGA2; FHL3; TRIM23; AKT1; BMI1; SPI1; SMAD4; ELAVL1; KAT2A; EP300; MED1; POU1F1; POU2AF1; ZBTB32; ZFPM1; ZBTB16; HDAC5; HDAC3; HHEX; RARA; RXRA; MAPK1; JUN; CEBPA; STAT3; PML;
Write Your Own Review
You're reviewing:GATA2 Antibody - N-terminal region (ARP31855_T100)
Your Rating