Size:100 ul
$319.00
In Stock
SKU
ARP40175_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40175_P050-FITC Conjugated

ARP40175_P050-HRP Conjugated

ARP40175_P050-Biotin Conjugated

GAPDH Antibody - N-terminal region (ARP40175_P050)

Rating:
100% of 100
Catalog#: ARP40175_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-113612, HPA040067
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GAPDH
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-GAPDH (ARP40175_P050)
Peptide Sequence Synthetic peptide located within the following region: IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GAPDH (ARP40175_P050) antibody is Catalog # AAP40175 (Previous Catalog # AAPP22021)
Datasheets/Manuals Printable datasheet for anti-GAPDH (ARP40175_P050) antibody
Sample Type Confirmation

GAPDH is strongly supported by BioGPS gene expression data to be expressed in HeLa

Target Reference Rinne,T., (2008) Hum. Mol. Genet. 17 (13), 1968-1977
Publications

Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225-38 (2013). WB, IHC, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23931754

Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). WB, IHC, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 24793116

Gene Symbol GAPDH
Official Gene Full Name Glyceraldehyde-3-phosphate dehydrogenase
Alias Symbols G3PD, GAPD, MGC88685
NCBI Gene Id 2597
Protein Name Glyceraldehyde-3-phosphate dehydrogenase RuleBase RU003389
Description of Target GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome.Glyceraldehyde-3-phosphate dehydrogenase catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. A GAPD pseudogene has been mapped to Xp21-p11 and 15 GAPD-like loci have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q2TSD0
Protein Accession # NP_002037
Nucleotide Accession # NM_002046
Protein Size (# AA) 335
Molecular Weight 36kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GAPDH.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GAPDH.
Protein Interactions FUS; HUWE1; UBC; SUMO2; SUMO3; STAU1; MDM2; GAPDH; ASB15; ASB16; RPA3; RPA2; RPA1; EED; SNCA; rev; HSPA9; HSPA1L; GAS7; TUBA1A; TUFM; RAP1GDS1; PPP5C; PPIB; YWHAG; TUBB; TUBA1C; PRPF40A; UBQLN1; DCPS; MAT2B; ACOT7; METAP2; FERMT2; GBP1; EEF1A1; TYMP; DFFA
  1. What is the species homology for "GAPDH Antibody - N-terminal region (ARP40175_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "GAPDH Antibody - N-terminal region (ARP40175_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GAPDH Antibody - N-terminal region (ARP40175_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GAPDH Antibody - N-terminal region (ARP40175_P050)"?

    This target may also be called "G3PD, GAPD, MGC88685" in publications.

  5. What is the shipping cost for "GAPDH Antibody - N-terminal region (ARP40175_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GAPDH Antibody - N-terminal region (ARP40175_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GAPDH Antibody - N-terminal region (ARP40175_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GAPDH Antibody - N-terminal region (ARP40175_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GAPDH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GAPDH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GAPDH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GAPDH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GAPDH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GAPDH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GAPDH Antibody - N-terminal region (ARP40175_P050)
Your Rating
We found other products you might like!