Search Antibody, Protein, and ELISA Kit Solutions

GALNT2 Antibody - middle region : FITC (ARP76183_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76183_P050 Unconjugated

ARP76183_P050-HRP Conjugated

ARP76183_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
GALNT2
Official Gene Full Name:
polypeptide N-acetylgalactosaminyltransferase 2
NCBI Gene Id:
2590
Protein Name:
polypeptide N-acetylgalactosaminyltransferase 2
Swissprot Id:
Q10471
Protein Accession #:
NP_004472
Alias Symbols:
GalNAc-T2
Description of Target:
This gene encodes a member of the glycosyltransferase 2 protein family. Members of this family initiate mucin-type O-glycoslation of peptides in the Golgi apparatus. The encoded protein may be involved in O-linked glycosylation of the immunoglobulin A1 hinge region. This gene may influence triglyceride levels, and may be involved Type 2 diabetes, as well as several types of cancer. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
571
Molecular Weight:
62kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GALNT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GALNT2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human GALT2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: IDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-GALNT2 (ARP76183_P050-FITC) antibody is Catalog # AAP76183
Datasheets/Manuals:
Printable datasheet for anti-GALNT2 (ARP76183_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...