GALC Antibody - middle region (ARP44847_P050)

Catalog No: ARP44847_P050 (Formerly GWB-MP962H )

WB Suggested Anti-GALC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Host: Rabbit
Target Name: GALC
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GALC
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GALC (ARP44847_P050) antibody is Catalog # AAP44847 (Previous Catalog # AAPP25926)
• Reference: Formichi,P., (2007) J. Cell. Physiol. 212 (3), 737-743

Target Info

• Gene Symbol: GALC
• Gene Full Name: Galactosylceramidase
• Alias Symbols: -
• NCBI Gene Id: 2581
• Protein Name: Galactocerebrosidase
• Description of Target: GALC is a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy.This gene encodes a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Uniprot ID: P54803
• Protein Accession #: NP_000144
• Nucleotide Accession #: NM_000153
• Protein Size (# AA): 685
• Molecular Weight: 73kDa
• Protein Interactions: TRAF3;