GAL Antibody - middle region : FITC (AVARP13036_P050-FITC)

Catalog No: AVARP13036_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAL
• Predicted Homology Based on Immunogen Sequence: Dog: 76%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GAL (AVARP13036_P050-FITC) antibody is Catalog # AAP30699 (Previous Catalog # AAPP01356)
• Sample Type Confirmation:

  GAL is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Reference: Levran,O., (er) Genes Brain Behav. (2008) In press

Target Info

• Gene Symbol: GAL
• Gene Full Name: Galanin prepropeptide
• Alias Symbols: ETL8, GALN, GLNN, GMAP, GAL-GMAP
• NCBI Gene Id: 51083
• Protein Name: Galanin peptides
• Description of Target: Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions.
• Uniprot ID: P22466
• Protein Accession #: NP_057057
• Nucleotide Accession #: NM_015973
• Protein Size (# AA): 123
• Molecular Weight: 13kDa
• Protein Interactions: SGTA; ELAVL1; GPR151; GALR2; GALR1;