Size:100 ul
$319.00
In stock
SKU
ARP48346_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48346_P050-FITC Conjugated

ARP48346_P050-HRP Conjugated

ARP48346_P050-Biotin Conjugated

More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-133606, HPA029816
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GADD45B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology dataAnti-GADD45B (ARP48346_P050)
Peptide SequenceSynthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-GADD45B (ARP48346_P050) antibody is Catalog # AAP48346 (Previous Catalog # AAPY01724)
Datasheets/ManualsPrintable datasheet for anti-GADD45B (ARP48346_P050) antibody
Target ReferenceTornatore,L., (2008) J. Mol. Biol. 378 (1), 97-111
Publications

Babu, E. et al. Role of SLC5A8, a plasma membrane transporter and a tumor suppressor, in the antitumor activity of dichloroacetate. Oncogene 30, 4026-37 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 21505039

Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 22048458

Gavin, DP; Kusumo, H; Zhang, H; Guidotti, A; Pandey, SC; Role of Growth Arrest and DNA Damage-Inducible, Beta in Alcohol-Drinking Behaviors. 40, 263-72 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 26842245

Ursini, G; Cavalleri, T; Fazio, L; Angrisano, T; Iacovelli, L; Porcelli, A; Maddalena, G; Punzi, G; Mancini, M; Gelao, B; Romano, R; Masellis, R; Calabrese, F; Rampino, A; Taurisano, P; Di Giorgio, A; Keller, S; Tarantini, L; Sinibaldi, L; Quarto, T; Popolizio, T; Caforio, G; Blasi, G; Riva, MA; De Blasi, A; Chiariotti, L; Bollati, V; Bertolino, A; BDNF rs6265 methylation and genotype interact on risk for schizophrenia. 11, 11-23 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 26889735

Gene SymbolGADD45B
Official Gene Full NameGrowth arrest and DNA-damage-inducible, beta
Alias SymbolsDKFZP566B133, GADD45BETA, MYD118
NCBI Gene Id4616
Protein NameGrowth arrest and DNA damage-inducible protein GADD45 beta
Description of TargetThe function of GADD45B is involved in the regulation of growth and apoptosis.This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdO75293
Protein Accession #NP_056490
Nucleotide Accession #NM_015675
Protein Size (# AA)160
Molecular Weight18kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express GADD45B.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express GADD45B.
Protein InteractionsUBD; UBC; MAP3K4; GADD45GIP1; GADD45G; MAP2K7; MAP3K5; PPARG; PPARD; PCNA; PPARA; ESR1; CCNB1; CDK1; CDKN1A; GADD45A; EGR1;
Write Your Own Review
You're reviewing:GADD45B Antibody - middle region (ARP48346_P050)
Your Rating
Aviva Travel Grant
Aviva Tips and Tricks
Free Microscope
Aviva Live Chat