Search Antibody, Protein, and ELISA Kit Solutions

GADD45B Antibody - middle region (ARP48346_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48346_P050-FITC Conjugated

ARP48346_P050-HRP Conjugated

ARP48346_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Growth arrest and DNA-damage-inducible, beta
NCBI Gene Id:
Protein Name:
Growth arrest and DNA damage-inducible protein GADD45 beta
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133606, HPA029816
Description of Target:
The function of GADD45B is involved in the regulation of growth and apoptosis.This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GADD45B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GADD45B.
The immunogen is a synthetic peptide directed towards the middle region of human GADD45B
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-GADD45B (ARP48346_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GADD45B (ARP48346_P050) antibody is Catalog # AAP48346 (Previous Catalog # AAPY01724)
Printable datasheet for anti-GADD45B (ARP48346_P050) antibody
Target Reference:
Tornatore,L., (2008) J. Mol. Biol. 378 (1), 97-111

Babu, E. et al. Role of SLC5A8, a plasma membrane transporter and a tumor suppressor, in the antitumor activity of dichloroacetate. Oncogene 30, 4026-37 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 21505039

Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 22048458

Gavin, DP; Kusumo, H; Zhang, H; Guidotti, A; Pandey, SC; Role of Growth Arrest and DNA Damage-Inducible, Beta in Alcohol-Drinking Behaviors. 40, 263-72 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 26842245

Ursini, G; Cavalleri, T; Fazio, L; Angrisano, T; Iacovelli, L; Porcelli, A; Maddalena, G; Punzi, G; Mancini, M; Gelao, B; Romano, R; Masellis, R; Calabrese, F; Rampino, A; Taurisano, P; Di Giorgio, A; Keller, S; Tarantini, L; Sinibaldi, L; Quarto, T; Popolizio, T; Caforio, G; Blasi, G; Riva, MA; De Blasi, A; Chiariotti, L; Bollati, V; Bertolino, A; BDNF rs6265 methylation and genotype interact on risk for schizophrenia. 11, 11-23 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 26889735

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...