Size:100 ul
$319.00
In Stock
SKU
ARP48346_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48346_P050-FITC Conjugated

ARP48346_P050-HRP Conjugated

ARP48346_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133606, HPA029816
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GADD45B
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data Anti-GADD45B (ARP48346_P050)
Peptide Sequence Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GADD45B (ARP48346_P050) antibody is Catalog # AAP48346 (Previous Catalog # AAPY01724)
Datasheets/Manuals Printable datasheet for anti-GADD45B (ARP48346_P050) antibody
Target Reference Tornatore,L., (2008) J. Mol. Biol. 378 (1), 97-111
Publications

Babu, E. et al. Role of SLC5A8, a plasma membrane transporter and a tumor suppressor, in the antitumor activity of dichloroacetate. Oncogene 30, 4026-37 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 21505039

Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 22048458

Gavin, DP; Kusumo, H; Zhang, H; Guidotti, A; Pandey, SC; Role of Growth Arrest and DNA Damage-Inducible, Beta in Alcohol-Drinking Behaviors. 40, 263-72 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 26842245

Ursini, G; Cavalleri, T; Fazio, L; Angrisano, T; Iacovelli, L; Porcelli, A; Maddalena, G; Punzi, G; Mancini, M; Gelao, B; Romano, R; Masellis, R; Calabrese, F; Rampino, A; Taurisano, P; Di Giorgio, A; Keller, S; Tarantini, L; Sinibaldi, L; Quarto, T; Popolizio, T; Caforio, G; Blasi, G; Riva, MA; De Blasi, A; Chiariotti, L; Bollati, V; Bertolino, A; BDNF rs6265 methylation and genotype interact on risk for schizophrenia. 11, 11-23 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 26889735

Gene Symbol GADD45B
Official Gene Full Name Growth arrest and DNA-damage-inducible, beta
Alias Symbols DKFZP566B133, GADD45BETA, MYD118
NCBI Gene Id 4616
Protein Name Growth arrest and DNA damage-inducible protein GADD45 beta
Description of Target The function of GADD45B is involved in the regulation of growth and apoptosis.This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O75293
Protein Accession # NP_056490
Nucleotide Accession # NM_015675
Protein Size (# AA) 160
Molecular Weight 18kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GADD45B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GADD45B.
Protein Interactions UBD; UBC; MAP3K4; GADD45GIP1; GADD45G; MAP2K7; MAP3K5; PPARG; PPARD; PCNA; PPARA; ESR1; CCNB1; CDK1; CDKN1A; GADD45A; EGR1;
  1. What is the species homology for "GADD45B Antibody - middle region (ARP48346_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat".

  2. How long will it take to receive "GADD45B Antibody - middle region (ARP48346_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GADD45B Antibody - middle region (ARP48346_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GADD45B Antibody - middle region (ARP48346_P050)"?

    This target may also be called "DKFZP566B133, GADD45BETA, MYD118" in publications.

  5. What is the shipping cost for "GADD45B Antibody - middle region (ARP48346_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GADD45B Antibody - middle region (ARP48346_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GADD45B Antibody - middle region (ARP48346_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "18kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GADD45B Antibody - middle region (ARP48346_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GADD45B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GADD45B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GADD45B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GADD45B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GADD45B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GADD45B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GADD45B Antibody - middle region (ARP48346_P050)
Your Rating
We found other products you might like!