Search Antibody, Protein, and ELISA Kit Solutions

GAD2 Antibody - N-terminal region : FITC (ARP74935_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74935_P050 Unconjugated

ARP74935_P050-HRP Conjugated

ARP74935_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
GAD2
Official Gene Full Name:
glutamate decarboxylase 2
NCBI Gene Id:
2572
Protein Name:
glutamate decarboxylase 2
Swissprot Id:
Q05329
Protein Accession #:
NP_001127838
Alias Symbols:
GAD65
Description of Target:
This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.
Protein Size (# AA):
585
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GAD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GAD2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCE2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: FGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CMTM5; MAL2; TMEM159; AGTRAP; ARL6IP1; GAD1; F10; PRKCE; PRKACA; ZDHHC17;
Blocking Peptide:
For anti-GAD2 (ARP74935_P050-FITC) antibody is Catalog # AAP74935
Datasheets/Manuals:
Printable datasheet for anti-GAD2 (ARP74935_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...