GAD2 Antibody - N-terminal region : FITC (ARP74935_P050-FITC)

Catalog No: ARP74935_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCE2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: FGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GAD2 (ARP74935_P050-FITC) antibody is Catalog # AAP74935

Target Info

• Gene Symbol: GAD2
• Gene Full Name: glutamate decarboxylase 2
• Alias Symbols: GAD65
• NCBI Gene Id: 2572
• Protein Name: glutamate decarboxylase 2
• Description of Target: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.
• Uniprot ID: Q05329
• Protein Accession #: NP_001127838
• Protein Size (# AA): 585
• Molecular Weight: 64kDa
• Protein Interactions: CMTM5; MAL2; TMEM159; AGTRAP; ARL6IP1; GAD1; F10; PRKCE; PRKACA; ZDHHC17;