GAD1 Antibody - N-terminal region (ARP74535_P050)

Catalog No: ARP74535_P050

Host: Rabbit
Target Name: GAD1
Sample Tissue: 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GAD1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: CENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GAD1 (ARP74535_P050) antibody is Catalog # AAP74535

Target Info

• Gene Symbol: GAD1
• Gene Full Name: glutamate decarboxylase 1
• Alias Symbols: GAD, SCP, CPSQ1, DEE89
• NCBI Gene Id: 2571
• Protein Name: glutamate decarboxylase 1
• Description of Target: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form.
• Uniprot ID: Q99259
• Protein Accession #: NP_000808.2
• Nucleotide Accession #: NM_000817.2
• Protein Size (# AA): 594
• Molecular Weight: 65 kDa