Size:100 ul
$319.00
In Stock
SKU
ARP35060_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35060_P050-FITC Conjugated

ARP35060_P050-HRP Conjugated

ARP35060_P050-Biotin Conjugated

GABRR2 Antibody - middle region (ARP35060_P050)

Catalog#: ARP35060_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item HPA016467
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GABRR2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-GABRR2 (ARP35060_P050)
Peptide Sequence Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GABRR2 (ARP35060_P050) antibody is Catalog # AAP35060 (Previous Catalog # AAPP06287)
Datasheets/Manuals Printable datasheet for anti-GABRR2 (ARP35060_P050) antibody
Sample Type Confirmation

GABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T

Subunit rho-2
Target Reference Cavalleri,G.L., (2007) Lancet Neurol 6 (11), 970-980
Publications

Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders; relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23778581

Gene Symbol GABRR2
Official Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, rho 2
Alias Symbols -
NCBI Gene Id 2570
Protein Name Gamma-aminobutyric acid receptor subunit rho-2
Description of Target GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 BX490975.1 60-89 31-1586 BC130352.1 1-1556 1587-1631 M86868.1 1584-1628
Swissprot Id P28476
Protein Accession # NP_002034
Nucleotide Accession # NM_002043
Protein Size (# AA) 490
Molecular Weight 54kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GABRR2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GABRR2.
Protein Interactions GABRR1; SQSTM1; PRKCA; MAP1B; CSNK2A1;
  1. What is the species homology for "GABRR2 Antibody - middle region (ARP35060_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "GABRR2 Antibody - middle region (ARP35060_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GABRR2 Antibody - middle region (ARP35060_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GABRR2 Antibody - middle region (ARP35060_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "GABRR2 Antibody - middle region (ARP35060_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GABRR2 Antibody - middle region (ARP35060_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GABRR2 Antibody - middle region (ARP35060_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GABRR2 Antibody - middle region (ARP35060_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GABRR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GABRR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GABRR2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GABRR2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GABRR2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GABRR2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GABRR2 Antibody - middle region (ARP35060_P050)
Your Rating
We found other products you might like!