Search Antibody, Protein, and ELISA Kit Solutions

GABRR2 Antibody - middle region (ARP35060_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35060_P050-FITC Conjugated

ARP35060_P050-HRP Conjugated

ARP35060_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item HPA016467
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GABRR2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-GABRR2 (ARP35060_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GABRR2 (ARP35060_P050) antibody is Catalog # AAP35060 (Previous Catalog # AAPP06287)
Datasheets/Manuals:
Printable datasheet for anti-GABRR2 (ARP35060_P050) antibody
Sample Type Confirmation:

GABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T

Subunit:
rho-2
Target Reference:
Cavalleri,G.L., (2007) Lancet Neurol 6 (11), 970-980
Publications:

Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders; relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23778581

Gene Symbol:
GABRR2
Official Gene Full Name:
Gamma-aminobutyric acid (GABA) A receptor, rho 2
Alias Symbols:
-
NCBI Gene Id:
2570
Protein Name:
Gamma-aminobutyric acid receptor subunit rho-2
Description of Target:
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 BX490975.1 60-89 31-1586 BC130352.1 1-1556 1587-1631 M86868.1 1584-1628
Swissprot Id:
P28476
Protein Accession #:
NP_002034
Nucleotide Accession #:
NM_002043
Protein Size (# AA):
490
Molecular Weight:
54kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GABRR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GABRR2.
Protein Interactions:
GABRR1; SQSTM1; PRKCA; MAP1B; CSNK2A1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...