Search Antibody, Protein, and ELISA Kit Solutions

GABRQ Antibody - N-terminal region (ARP35283_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35283_P050-FITC Conjugated

ARP35283_P050-HRP Conjugated

ARP35283_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
GABRQ
Official Gene Full Name:
Gamma-aminobutyric acid (GABA) A receptor, theta
NCBI Gene Id:
55879
Protein Name:
Gamma-aminobutyric acid receptor subunit theta
Swissprot Id:
Q9UN88
Protein Accession #:
NP_061028
Nucleotide Accession #:
NM_018558
Alias Symbols:
THETA
Description of Target:
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases:early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. It is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases: early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).
Protein Size (# AA):
632
Molecular Weight:
72kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GABRQ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GABRQ.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRQ
Predicted Homology Based on Immunogen Sequence:
Cow: 87%; Dog: 87%; Guinea Pig: 80%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GABRQ (ARP35283_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GABRQ (ARP35283_P050) antibody is Catalog # AAP35283 (Previous Catalog # AAPP06521)
Datasheets/Manuals:
Printable datasheet for anti-GABRQ (ARP35283_P050) antibody
Subunit:
theta
Target Reference:
Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595
Publications:

Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders; relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23778581

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...