Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP35283_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35283_P050-FITC Conjugated

ARP35283_P050-HRP Conjugated

ARP35283_P050-Biotin Conjugated

GABRQ Antibody - N-terminal region (ARP35283_P050)

Catalog#: ARP35283_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GABRQ
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 87%; Dog: 87%; Guinea Pig: 80%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-GABRQ (ARP35283_P050)
Peptide Sequence Synthetic peptide located within the following region: KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GABRQ (ARP35283_P050) antibody is Catalog # AAP35283 (Previous Catalog # AAPP06521)
Datasheets/Manuals Printable datasheet for anti-GABRQ (ARP35283_P050) antibody
Subunit theta
Target Reference Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595
Publications

Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders; relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23778581

Gene Symbol GABRQ
Official Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, theta
Alias Symbols THETA
NCBI Gene Id 55879
Protein Name Gamma-aminobutyric acid receptor subunit theta
Description of Target The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases:early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. It is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases: early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).
Swissprot Id Q9UN88
Protein Accession # NP_061028
Nucleotide Accession # NM_018558
Protein Size (# AA) 632
Molecular Weight 72kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GABRQ.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GABRQ.
Write Your Own Review
You're reviewing:GABRQ Antibody - N-terminal region (ARP35283_P050)
Your Rating