Search Antibody, Protein, and ELISA Kit Solutions

GABRQ Antibody - N-terminal region (ARP35283_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35283_P050-FITC Conjugated

ARP35283_P050-HRP Conjugated

ARP35283_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Gamma-aminobutyric acid (GABA) A receptor, theta
NCBI Gene Id:
Protein Name:
Gamma-aminobutyric acid receptor subunit theta
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases:early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. It is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases: early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GABRQ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GABRQ.
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRQ
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 87%; Dog: 87%; Guinea Pig: 80%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GABRQ (ARP35283_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GABRQ (ARP35283_P050) antibody is Catalog # AAP35283 (Previous Catalog # AAPP06521)
Printable datasheet for anti-GABRQ (ARP35283_P050) antibody
Target Reference:
Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595

Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders; relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23778581

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...