Search Antibody, Protein, and ELISA Kit Solutions

GABRQ Antibody - N-terminal region (ARP35283_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP35283_P050-FITC Conjugated

ARP35283_P050-HRP Conjugated

ARP35283_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRQ
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 87%; Dog: 87%; Guinea Pig: 80%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GABRQ (ARP35283_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GABRQ (ARP35283_P050) antibody is Catalog # AAP35283 (Previous Catalog # AAPP06521)
Datasheets/Manuals:
Printable datasheet for anti-GABRQ (ARP35283_P050) antibody
Subunit:
theta
Target Reference:
Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595
Publications:

Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders; relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23778581

Gene Symbol:
GABRQ
Official Gene Full Name:
Gamma-aminobutyric acid (GABA) A receptor, theta
Alias Symbols:
THETA
NCBI Gene Id:
55879
Protein Name:
Gamma-aminobutyric acid receptor subunit theta
Description of Target:
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases:early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. It is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases: early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).
Swissprot Id:
Q9UN88
Protein Accession #:
NP_061028
Nucleotide Accession #:
NM_018558
Protein Size (# AA):
632
Molecular Weight:
72kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GABRQ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GABRQ.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...