- Gene Symbol:
- GABRQ
- NCBI Gene Id:
- 55879
- Official Gene Full Name:
- Gamma-aminobutyric acid (GABA) A receptor, theta
- Protein Name:
- Gamma-aminobutyric acid receptor subunit theta
- Swissprot Id:
- Q9UN88
- Protein Accession #:
- NP_061028
- Nucleotide Accession #:
- NM_018558
- Alias Symbols:
- THETA
- Description of Target:
- The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases:early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. It is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases: early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).
- Protein Size (# AA):
- 632
- Molecular Weight:
- 72kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express GABRQ.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express GABRQ.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human GABRQ
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 87%; Dog: 87%; Guinea Pig: 80%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
- Complete computational species homology data:
- Anti-GABRQ (ARP35283_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-GABRQ (ARP35283_P050) antibody is Catalog # AAP35283 (Previous Catalog # AAPP06521)
- Datasheets/Manuals:
- Printable datasheet for anti-GABRQ (ARP35283_P050) antibody
- Subunit:
- theta
- Target Reference:
- Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595
- Publications:
Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders; relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23778581
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
