SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: AVARP13034_P050-FITC
Size:100ul
Price: $434.00
SKU
AVARP13034_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-GABRP (AVARP13034_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GABRP
Predicted Homology Based on Immunogen SequenceDog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE
Concentration0.5 mg/ml
Blocking PeptideFor anti-GABRP (AVARP13034_P050-FITC) antibody is Catalog # AAP30695 (Previous Catalog # AAPP01352)
Subunitpi
ReferenceNeelands,T.R. et al., (1999) Mol. Pharmacol. 56 (3), 598-610
Gene SymbolGABRP
Gene Full NameGamma-aminobutyric acid (GABA) A receptor, pi
Alias SymbolsMGC126386, MGC126387
NCBI Gene Id2568
Protein NameGamma-aminobutyric acid receptor subunit pi
Description of TargetThe gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. The subunit encoded GABRP is expressed in several non-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits, and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone.The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. The subunit encoded by this gene is expressed in several non-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits, and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone.
Uniprot IDO00591
Protein Accession #NP_055026
Nucleotide Accession #NM_014211
Protein Size (# AA)440
Molecular Weight51kDa
  1. What is the species homology for "GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse, Rabbit".

  2. How long will it take to receive "GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)"?

    This target may also be called "MGC126386, MGC126387" in publications.

  5. What is the shipping cost for "GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GABRP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GABRP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GABRP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GABRP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GABRP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GABRP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GABRP Antibody - N-terminal region : FITC (AVARP13034_P050-FITC)
Your Rating
We found other products you might like!