Size:100 ul
$319.00
In Stock
SKU
ARP35342_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35342_P050-FITC Conjugated

ARP35342_P050-HRP Conjugated

ARP35342_P050-Biotin Conjugated

GABRE Antibody - middle region (ARP35342_P050)

Catalog#: ARP35342_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GABRE
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 79%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 92%
Complete computational species homology data Anti-GABRE (ARP35342_P050)
Peptide Sequence Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GABRE (ARP35342_P050) antibody is Catalog # AAP35342 (Previous Catalog # AAPP06577)
Datasheets/Manuals Printable datasheet for anti-GABRE (ARP35342_P050) antibody
Subunit epsilon
Target Reference Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595
Publications

Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. Expression of GABAA -alpha2-, b1- and Îu-receptors are altered significantly in the lateral cerebellum of subjects with schizophrenia, major depression and bipolar disorder. Transl. Psychiatry 3, e303 (2013). WB, Guinea Pig, Human, Mouse, Rabbit, Rat 24022508

Hengen, K. B. et al. Increased GABA(A) receptor Îu-subunit expression on ventral respiratory column neurons protects breathing during pregnancy. PLoS One 7, e30608 (2012). WB, Guinea Pig, Human, Mouse, Rabbit, Rat 22303446

Hengen, K. B., Gomez, T. M., Stang, K. M., Johnson, S. M. & Behan, M. Changes in ventral respiratory column GABAaR Îu- and δ-subunits during hibernation mediate resistance to depression by EtOH and pentobarbital. Am. J. Physiol. Regul. Integr. Comp. Physiol. 300, R272-83 (2011). WB, Guinea Pig, Human, Mouse, Rabbit, Rat 21084677

Gene Symbol GABRE
Official Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, epsilon
NCBI Gene Id 2564
Description of Target GABRE belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants encoding different isoforms have been identified.
Swissprot Id P78334
Protein Accession # NP_068819
Nucleotide Accession # NM_021984
Protein Size (# AA) 393
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GABRE.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GABRE.
  1. What is the species homology for "GABRE Antibody - middle region (ARP35342_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "GABRE Antibody - middle region (ARP35342_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GABRE Antibody - middle region (ARP35342_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GABRE Antibody - middle region (ARP35342_P050)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "GABRE Antibody - middle region (ARP35342_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GABRE Antibody - middle region (ARP35342_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GABRE Antibody - middle region (ARP35342_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GABRE Antibody - middle region (ARP35342_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GABRE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GABRE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GABRE"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GABRE"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GABRE"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GABRE"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GABRE Antibody - middle region (ARP35342_P050)
Your Rating
We found other products you might like!