Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GABRE antibody - middle region (ARP35342_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP35342_P050-FITC Conjugated

ARP35342_P050-HRP Conjugated

ARP35342_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
GABRE
NCBI Gene Id:
2564
Official Gene Full Name:
Gamma-aminobutyric acid (GABA) A receptor, epsilon
Swissprot Id:
P78334
Protein Accession #:
NP_068819
Nucleotide Accession #:
NM_021984
Description of Target:
GABRE belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Size (# AA):
393
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GABRE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GABRE.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GABRE
Species Reactivity:
Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 79%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 92%
Complete computational species homology data:
Anti-GABRE (ARP35342_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GABRE (ARP35342_P050) antibody is Catalog # AAP35342 (Previous Catalog # AAPP06577)
Datasheets/Manuals:
Printable datasheet for anti-GABRE (ARP35342_P050) antibody
Subunit:
epsilon
Target Reference:
Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595
Publications:

Hengen, K. B., Gomez, T. M., Stang, K. M., Johnson, S. M. & Behan, M. Changes in ventral respiratory column GABAaR ε- and δ-subunits during hibernation mediate resistance to depression by EtOH and pentobarbital. Am. J. Physiol. Regul. Integr. Comp. Physiol. 300, R272-83 (2011). WB, Guinea Pig, Human, Mouse, Rabbit, Rat 21084677

Hengen, K. B. et al. Increased GABA(A) receptor ε-subunit expression on ventral respiratory column neurons protects breathing during pregnancy. PLoS One 7, e30608 (2012). WB, Guinea Pig, Human, Mouse, Rabbit, Rat 22303446

Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. Expression of GABAA -alpha2-, β1- and ε-receptors are altered significantly in the lateral cerebellum of subjects with schizophrenia, major depression and bipolar disorder. Transl. Psychiatry 3, e303 (2013). WB, Guinea Pig, Human, Mouse, Rabbit, Rat 24022508

Tell us what you think about this item!

Write A Review
    Please, wait...