ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP57863_P050
Price: $0.00
SKU
ARP57863_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GABPB1 (ARP57863_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GABPB2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH
Concentration0.5 mg/ml
Blocking PeptideFor anti-GABPB1 (ARP57863_P050) antibody is Catalog # AAP57863 (Previous Catalog # AAPP32216)
Subunitbeta-1
ReferenceCrook,M.F., (2008) FASEB J. 22 (1), 225-235
Gene SymbolGABPB1
Gene Full NameGA binding protein transcription factor, beta subunit 1
Alias SymbolsE4TF1, GABPB, BABPB2, E4TF1B, GABPB2, NRF2B1, NRF2B2, GABPB-1, E4TF1-47, E4TF1-53
NCBI Gene Id2553
Protein NameGA-binding protein subunit beta-1
Description of TargetGABPB2 is the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Uniprot IDQ06547
Protein Accession #NP_002032
Nucleotide Accession #NM_002041
Protein Size (# AA)360
Molecular Weight38kDa
Protein InteractionsFAM90A1; RBM11; RSPH14; TDRD7; POGZ; LMO4; TRAF2; SNRPB2; SNRPA; LMO1; UBC; MAGEB18; RYBP; YAF2; YY1; GABPA; IL16; DHX16; CIC; LMO3; USO1; FANCG; BAI2; HCFC1; ATF1;
  1. What is the species homology for "GABPB2 Antibody - N-terminal region (ARP57863_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "GABPB2 Antibody - N-terminal region (ARP57863_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GABPB2 Antibody - N-terminal region (ARP57863_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GABPB2 Antibody - N-terminal region (ARP57863_P050)"?

    This target may also be called "E4TF1, GABPB, BABPB2, E4TF1B, GABPB2, NRF2B1, NRF2B2, GABPB-1, E4TF1-47, E4TF1-53" in publications.

  5. What is the shipping cost for "GABPB2 Antibody - N-terminal region (ARP57863_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GABPB2 Antibody - N-terminal region (ARP57863_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GABPB2 Antibody - N-terminal region (ARP57863_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GABPB2 Antibody - N-terminal region (ARP57863_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GABPB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GABPB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GABPB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GABPB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GABPB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GABPB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GABPB2 Antibody - N-terminal region (ARP57863_P050)
Your Rating
We found other products you might like!