GABPB2 Antibody - middle region (ARP31189_P050)

Catalog No: ARP31189_P050

WB Suggested Anti-GABPB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysateGABPB1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GABPB2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: EPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GABPB1 (ARP31189_P050) antibody is Catalog # AAP31189 (Previous Catalog # AAPP24041)
• Sample Type Confirmation:

  GABPB1 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• Subunit: beta-1

Target Info

• Reference: Crook,M.F., (2008) FASEB J. 22 (1), 225-235
• Gene Symbol: GABPB1
• Gene Full Name: GA binding protein transcription factor, beta subunit 1
• Alias Symbols: E4TF1, GABPB, BABPB2, E4TF1B, GABPB2, NRF2B1, NRF2B2, GABPB-1, E4TF1-47, E4TF1-53
• NCBI Gene Id: 2553
• Protein Name: GA-binding protein subunit beta-1
• Description of Target: GABPB2 is the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
• Uniprot ID: Q06547
• Protein Accession #: NP_005245
• Nucleotide Accession #: NM_005254
• Protein Size (# AA): 395
• Molecular Weight: 42kDa
• Protein Interactions: FAM90A1; RBM11; RSPH14; TDRD7; POGZ; LMO4; TRAF2; SNRPB2; SNRPA; LMO1; UBC; MAGEB18; RYBP; YAF2; YY1; GABPA; IL16; DHX16; CIC; LMO3; USO1; FANCG; BAI2; HCFC1; ATF1;