Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OAAF07318 (Formerly GWB-ASB011)
Size:100 ug
Price: $344.00
SKU
OAAF07318
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for GABA-RB Antibody (Phospho-Ser434) (OAAF07318)
Product Info
Predicted Species ReactivityHuman|Monkey|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Additional InformationModification Sites: Human:S434 Mouse:S434 Rat:S434
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human GABA-RB around the phosphorylation site of Ser434.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: SIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTDVNSID
Concentration1mg/ml
SpecificityGABA-RB (Phospho-Ser434) Antibody detects endogenous levels of GABA-RB only when phosphorylated at Ser434.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application InfoWB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:40000
Gene SymbolGABRB1
Gene Full Namegamma-aminobutyric acid type A receptor subunit beta1
Alias SymbolsDEE45;EIEE45;GABA(A) receptor subunit beta-1;gamma-aminobutyric acid (GABA) A receptor, beta 1;gamma-aminobutyric acid receptor subunit beta-1;gamma-aminobutyric acid type A receptor beta1 subunit.
NCBI Gene Id2560
Protein NameGamma-aminobutyric acid receptor subunit beta-1
Description of TargetComponent of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand-gated chloride channel.
Uniprot IDP18505
Molecular Weight54 kDa
  1. What is the species homology for "GABA-RB Antibody (Phospho-Ser434) (OAAF07318)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Monkey|Mouse|Rat".

  2. How long will it take to receive "GABA-RB Antibody (Phospho-Ser434) (OAAF07318)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "GABA-RB Antibody (Phospho-Ser434) (OAAF07318)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GABA-RB Antibody (Phospho-Ser434) (OAAF07318)"?

    This target may also be called "DEE45;EIEE45;GABA(A) receptor subunit beta-1;gamma-aminobutyric acid (GABA) A receptor, beta 1;gamma-aminobutyric acid receptor subunit beta-1;gamma-aminobutyric acid type A receptor beta1 subunit." in publications.

  5. What is the shipping cost for "GABA-RB Antibody (Phospho-Ser434) (OAAF07318)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GABA-RB Antibody (Phospho-Ser434) (OAAF07318)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GABA-RB Antibody (Phospho-Ser434) (OAAF07318)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GABA-RB Antibody (Phospho-Ser434) (OAAF07318)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GABRB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GABRB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GABRB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GABRB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GABRB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GABRB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GABA-RB Antibody (Phospho-Ser434) (OAAF07318)
Your Rating
We found other products you might like!