Size:100 ul
$319.00
In stock
SKU
ARP44226_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44226_P050-FITC Conjugated

ARP44226_P050-HRP Conjugated

ARP44226_P050-Biotin Conjugated

GAA Antibody - N-terminal region (ARP44226_P050)

Catalog#: ARP44226_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-115825 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GAA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 83%
Complete computational species homology data Anti-GAA (ARP44226_P050)
Peptide Sequence Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GAA (ARP44226_P050) antibody is Catalog # AAP44226 (Previous Catalog # AAPP25606)
Datasheets/Manuals Printable datasheet for anti-GAA (ARP44226_P050) antibody
Sample Type Confirmation

GAA is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference Wan,L., (er) J. Neurol. (2008) In press
Gene Symbol GAA
Official Gene Full Name Glucosidase, alpha; acid
Alias Symbols LYAG
NCBI Gene Id 2548
Protein Name Lysosomal alpha-glucosidase
Description of Target GAA is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. This gene encodes acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Three transcript variants encoding the same protein have been found for this gene.
Swissprot Id P10253
Protein Accession # NP_000143
Nucleotide Accession # NM_000152
Protein Size (# AA) 952
Molecular Weight 98kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GAA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GAA.
Protein Interactions UBC; SUMO1; NEDD8; NUMBL; STAT2; HIVEP1; EP300; SYNCRIP; MTHFD1; ILF3; HNRNPK; CDH2; CALU; FBXO6; NCF1;
Write Your Own Review
You're reviewing:GAA Antibody - N-terminal region (ARP44226_P050)
Your Rating