Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GAA antibody - N-terminal region (ARP44226_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP44226_P050-FITC Conjugated

ARP44226_P050-HRP Conjugated

ARP44226_P050-Biotin Conjugated

Gene Symbol:
GAA
NCBI Gene Id:
2548
Official Gene Full Name:
Glucosidase, alpha; acid
Protein Name:
Lysosomal alpha-glucosidase
Swissprot Id:
P10253
Protein Accession #:
NP_000143
Nucleotide Accession #:
NM_000152
Alias Symbols:
LYAG
Replacement Item:
This antibody may replace item sc-115825 from Santa Cruz Biotechnology.
Description of Target:
GAA is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. This gene encodes acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Three transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
952
Molecular Weight:
98kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GAA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GAA.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GAA
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 83%
Complete computational species homology data:
Anti-GAA (ARP44226_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SUMO1; NEDD8; NUMBL; STAT2; HIVEP1; EP300; SYNCRIP; MTHFD1; ILF3; HNRNPK; CDH2; CALU; FBXO6; NCF1;
Blocking Peptide:
For anti-GAA (ARP44226_P050) antibody is Catalog # AAP44226 (Previous Catalog # AAPP25606)
Datasheets/Manuals:
Printable datasheet for anti-GAA (ARP44226_P050) antibody
Sample Type Confirmation:

GAA is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Wan,L., (er) J. Neurol. (2008) In press

Tell us what you think about this item!

Write A Review
    Please, wait...