GAA Antibody - N-terminal region (ARP44226_P050)

Size:100 ul

Human MCF-7

Human Lung Tissue

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-115825 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GAA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 83%
• Complete computational species homology data: Anti-GAA (ARP44226_P050)
• Peptide Sequence: Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-GAA (ARP44226_P050) antibody is Catalog # AAP44226 (Previous Catalog # AAPP25606)
• Datasheets/Manuals: Printable datasheet for anti-GAA (ARP44226_P050) antibody
• Sample Type Confirmation:

  GAA is supported by BioGPS gene expression data to be expressed in MCF7

• Target Reference: Wan,L., (er) J. Neurol. (2008) In press

Target Info

• Gene Symbol: GAA
• Official Gene Full Name: Glucosidase, alpha; acid
• Alias Symbols: LYAG
• NCBI Gene Id: 2548
• Protein Name: Lysosomal alpha-glucosidase
• Description of Target: GAA is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. This gene encodes acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Three transcript variants encoding the same protein have been found for this gene.
• Swissprot Id: P10253
• Protein Accession #: NP_000143
• Nucleotide Accession #: NM_000152
• Protein Size (# AA): 952
• Molecular Weight: 98kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express GAA.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express GAA.
• Protein Interactions: UBC; SUMO1; NEDD8; NUMBL; STAT2; HIVEP1; EP300; SYNCRIP; MTHFD1; ILF3; HNRNPK; CDH2; CALU; FBXO6; NCF1;