SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP44224_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP44224_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-G6PC (ARP44224_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Additional InformationIHC Information: Kidney, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human G6PC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 93%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
Concentration0.5 mg/ml
Blocking PeptideFor anti-G6PC (ARP44224_P050-FITC) antibody is Catalog # AAP44224 (Previous Catalog # AAPP25604)
ReferenceBarkaoui,E., J. Inherit. Metab. Dis. 30 (6), 989 (2007)
Publications

Iwasa, M. et al. Branched-chain amino acid supplementation reduces oxidative stress and prolongs survival in rats with advanced liver cirrhosis. PLoS One 8, e70309 (2013). WB, Sheep, Pig, Dog, Human, Rabbit, Rat, Horse, Guinea pig, Bovine, Mouse 23936183

Gene SymbolG6PC
Gene Full NameGlucose-6-phosphatase, catalytic subunit
Alias SymbolsG6PC, G6PT, GSD1, GSD1a, G6Pase
NCBI Gene Id2538
Protein NameGlucose-6-phosphatase
Description of TargetG6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum.It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP35575
Protein Accession #NP_000142
Nucleotide Accession #NM_000151
Protein Size (# AA)357
Molecular Weight40kDa
Protein InteractionsNSL1; SNX13; CDH16; FOXO1;
  1. What is the species homology for "G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)"?

    This target may also be called "G6PC, G6PT, GSD1, GSD1a, G6Pase" in publications.

  5. What is the shipping cost for "G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "G6PC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "G6PC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "G6PC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "G6PC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "G6PC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "G6PC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:G6PC Antibody - N-terminal region : FITC (ARP44224_P050-FITC)
Your Rating
We found other products you might like!