Size:100 ul
$319.00
In Stock
SKU
ARP44224_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44224_P050-FITC Conjugated

ARP44224_P050-HRP Conjugated

ARP44224_P050-Biotin Conjugated

More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Kidney, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-105380 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human G6PC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 93%; Sheep: 100%
Complete computational species homology dataAnti-G6PC (ARP44224_P050)
Peptide SequenceSynthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-G6PC (ARP44224_P050) antibody is Catalog # AAP44224 (Previous Catalog # AAPP25604)
Datasheets/ManualsPrintable datasheet for anti-G6PC (ARP44224_P050) antibody
Target ReferenceBarkaoui,E., J. Inherit. Metab. Dis. 30 (6), 989 (2007)
Publications

Iwasa, M. et al. Branched-chain amino acid supplementation reduces oxidative stress and prolongs survival in rats with advanced liver cirrhosis. PLoS One 8, e70309 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 23936183

Gene SymbolG6PC
Official Gene Full NameGlucose-6-phosphatase, catalytic subunit
Alias SymbolsG6PT, GSD1a, MGC163350, GSD1, G6PC1
NCBI Gene Id2538
Protein NameGlucose-6-phosphatase
Description of TargetG6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum.It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP35575
Protein Accession #NP_000142
Nucleotide Accession #NM_000151
Protein Size (# AA)357
Molecular Weight40kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express G6PC.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express G6PC.
Protein InteractionsNSL1; SNX13; CDH16; FOXO1;
  1. What is the species homology for "G6PC Antibody - N-terminal region (ARP44224_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep".

  2. How long will it take to receive "G6PC Antibody - N-terminal region (ARP44224_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "G6PC Antibody - N-terminal region (ARP44224_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "G6PC Antibody - N-terminal region (ARP44224_P050)"?

    This target may also be called "G6PT, GSD1a, MGC163350, GSD1, G6PC1" in publications.

  5. What is the shipping cost for "G6PC Antibody - N-terminal region (ARP44224_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "G6PC Antibody - N-terminal region (ARP44224_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "G6PC Antibody - N-terminal region (ARP44224_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "G6PC Antibody - N-terminal region (ARP44224_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "G6PC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "G6PC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "G6PC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "G6PC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "G6PC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "G6PC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:G6PC Antibody - N-terminal region (ARP44224_P050)
Your Rating
Aviva Blast Tool
Aviva Validation Data
Aviva Live Chat
Aviva Tissue Tool