Search Antibody, Protein, and ELISA Kit Solutions

G6PC antibody - N-terminal region (ARP44224_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44224_P050-FITC Conjugated

ARP44224_P050-HRP Conjugated

ARP44224_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Glucose-6-phosphatase, catalytic subunit
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
G6PT, GSD1a, MGC163350, GSD1, G6PC1
Replacement Item:
This antibody may replace item sc-105380 from Santa Cruz Biotechnology.
Description of Target:
G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum.It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express G6PC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express G6PC.
The immunogen is a synthetic peptide directed towards the N terminal region of human G6PC
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 93%; Sheep: 100%
Complete computational species homology data:
Anti-G6PC (ARP44224_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NSL1; SNX13; CDH16; FOXO1;
Blocking Peptide:
For anti-G6PC (ARP44224_P050) antibody is Catalog # AAP44224 (Previous Catalog # AAPP25604)
Printable datasheet for anti-G6PC (ARP44224_P050) antibody
Additional Information:
IHC Information: Kidney, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Barkaoui,E., J. Inherit. Metab. Dis. 30 (6), 989 (2007)

Iwasa, M. et al. Branched-chain amino acid supplementation reduces oxidative stress and prolongs survival in rats with advanced liver cirrhosis. PLoS One 8, e70309 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 23936183

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...