Size:100 ul
$319.00
In stock
SKU
ARP44223_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44223_P050-FITC Conjugated

ARP44223_P050-HRP Conjugated

ARP44223_P050-Biotin Conjugated

G6pc Antibody - N-terminal region (ARP44223_P050)

Catalog#: ARP44223_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105380 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 85%; Rat: 86%
Complete computational species homology data Anti-G6pc (ARP44223_P050)
Peptide Sequence Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-G6pc (ARP44223_P050) antibody is Catalog # AAP44223 (Previous Catalog # AAPP25603)
Datasheets/Manuals Printable datasheet for anti-G6pc (ARP44223_P050) antibody
Publications

Wang, PX; Ji, YX; Zhang, XJ; Zhao, LP; Yan, ZZ; Zhang, P; Shen, LJ; Yang, X; Fang, J; Tian, S; Zhu, XY; Gong, J; Zhang, X; Wei, QF; Wang, Y; Li, J; Wan, L; Xie, Q; She, ZG; Wang, Z; Huang, Z; Li, H; Targeting CASP8 and FADD-like apoptosis regulator ameliorates nonalcoholic steatohepatitis in mice and nonhuman primates. 23, 439-449 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 28218919

Wang, PX; Zhang, XJ; Luo, P; Jiang, X; Zhang, P; Guo, J; Zhao, GN; Zhu, X; Zhang, Y; Yang, S; Li, H; Hepatocyte TRAF3 promotes liver steatosis and systemic insulin resistance through targeting TAK1-dependent signalling. 7, 10592 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26882989

Gene Symbol G6pc
Official Gene Full Name Glucose-6-phosphatase, catalytic
Alias Symbols AW107337, G6Pase, G6pt, Glc-6-Pase
NCBI Gene Id 14377
Protein Name Glucose-6-phosphatase
Description of Target G6pc hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
Swissprot Id P35576
Protein Accession # NP_032087
Nucleotide Accession # NM_008061
Protein Size (# AA) 357
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express G6pc.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express G6pc.
Protein Interactions Ppargc1a; Foxo1; Sirt1;
Write Your Own Review
You're reviewing:G6pc Antibody - N-terminal region (ARP44223_P050)
Your Rating