Search Antibody, Protein, and ELISA Kit Solutions

G6pc Antibody - N-terminal region (ARP44223_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44223_P050-FITC Conjugated

ARP44223_P050-HRP Conjugated

ARP44223_P050-Biotin Conjugated

Gene Symbol:
G6pc
Official Gene Full Name:
Glucose-6-phosphatase, catalytic
NCBI Gene Id:
14377
Protein Name:
Glucose-6-phosphatase
Swissprot Id:
P35576
Protein Accession #:
NP_032087
Nucleotide Accession #:
NM_008061
Alias Symbols:
AW107337, G6Pase, G6pt, Glc-6-Pase
Replacement Item:
This antibody may replace item sc-105380 from Santa Cruz Biotechnology.
Description of Target:
G6pc hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
Protein Size (# AA):
357
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express G6pc.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express G6pc.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 85%; Rat: 86%
Complete computational species homology data:
Anti-G6pc (ARP44223_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Ppargc1a; Foxo1; Sirt1;
Blocking Peptide:
For anti-G6pc (ARP44223_P050) antibody is Catalog # AAP44223 (Previous Catalog # AAPP25603)
Datasheets/Manuals:
Printable datasheet for anti-G6pc (ARP44223_P050) antibody
Publications:

Wang, PX; Ji, YX; Zhang, XJ; Zhao, LP; Yan, ZZ; Zhang, P; Shen, LJ; Yang, X; Fang, J; Tian, S; Zhu, XY; Gong, J; Zhang, X; Wei, QF; Wang, Y; Li, J; Wan, L; Xie, Q; She, ZG; Wang, Z; Huang, Z; Li, H; Targeting CASP8 and FADD-like apoptosis regulator ameliorates nonalcoholic steatohepatitis in mice and nonhuman primates. 23, 439-449 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 28218919

Wang, PX; Zhang, XJ; Luo, P; Jiang, X; Zhang, P; Guo, J; Zhao, GN; Zhu, X; Zhang, Y; Yang, S; Li, H; Hepatocyte TRAF3 promotes liver steatosis and systemic insulin resistance through targeting TAK1-dependent signalling. 7, 10592 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26882989

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...