G3BP1 Antibody - N-terminal region (ARP37714_P050)

Catalog No: ARP37714_P050

WB Suggested Anti-G3BP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysateG3BP1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

Lanes:
1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)
Primary Antibody Dilution:
2ug/ml
Secondary Antibody:
IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution:
1: 20,000
Gene Name:
G3BP1
Submitted by:
Dr. Yuzhi Chen, University of Arkansas for Medical Science

Rabbit Anti-G3BP1 Antibody
Catalog Number: ARP37714_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic, plasma membrane
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

IP Suggested Anti-G3BP1 Antibody
Positive Control: NT2 CELL/BRAIN TISSUE

Amount and Sample Type:
500 ug rat brain homogenate
Amount of IP Antibody:
6 ug
Primary Antibody:
G3BP1
Primary Antibody Dilution:
1:500
Secondary Antibody:
Goat anti-rabbit Alexa-Fluor 594
Secondary Antibody Dilution:
1:5000
Gene Name:
G3BP1
Submitted by:
Dr. Yuzhi Chen, University of Arkansas for Medical Science

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IP, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-G3BP1 (ARP37714_P050) antibody is Catalog # AAP37714 (Previous Catalog # AAPP09046)
• Sample Type Confirmation:

  G3BP1 is strongly supported by BioGPS gene expression data to be expressed in HT1080

• Other Applications Image 1 Data: IP Suggested Anti-G3BP1 Antibody
  Positive Control: NT2 CELL/BRAIN TISSUE
  
• Reference: Zhang,H.Z., (2007) World J. Gastroenterol. 13 (30), 4126-4130
• Other Applications Image 2 Data: IP Suggested Anti-G3BP1 antibody
  Titration: 2 ug/ml
  Positive Control: Rat brain homogenate
  

Target Info

• Gene Symbol: G3BP1
• Gene Full Name: GTPase activating protein (SH3 domain) binding protein 1
• Alias Symbols: G3BP, HDH-VIII
• NCBI Gene Id: 10146
• Protein Name: Ras GTPase-activating protein-binding protein 1
• Description of Target: This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding
• Uniprot ID: Q13283
• Protein Accession #: NP_005745
• Nucleotide Accession #: NM_005754
• Protein Size (# AA): 466
• Molecular Weight: 52kDa
• Protein Interactions: UBC; USP10; FXR2; MDM2; RNF2; BMI1; RPS27L; EDC4; RPL35; RPL14; EIF2B3; EIF3C; PTBP1; PIN1; PA2G4; YBX1; HNRNPU; FAU; SH3RF2; TARDBP; FBXO25; RIOK2; SND1; VCAM1; env; ITGA4; IL7R; FN1; EPHA8; DTX1; PABPC1; PAXIP1; ESR1; APP; NOLC1; TPM4; LCK; CSK; KCND3;