Search Antibody, Protein, and ELISA Kit Solutions

G3BP Antibody - N-terminal region (ARP37713_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37713_T100-FITC Conjugated

ARP37713_T100-HRP Conjugated

ARP37713_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
G3BP1
Official Gene Full Name:
GTPase activating protein (SH3 domain) binding protein 1
NCBI Gene Id:
10146
Protein Name:
Ras GTPase-activating protein-binding protein 1
Swissprot Id:
Q13283
Protein Accession #:
NP_005745
Nucleotide Accession #:
NM_005754
Alias Symbols:
G3BP, HDH-VIII
Replacement Item:
This antibody may replace item sc-174777 from Santa Cruz Biotechnology.
Description of Target:
G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Protein Size (# AA):
466
Molecular Weight:
51kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express G3BP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express G3BP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-G3BP (ARP37713_T100)
Peptide Sequence:
Synthetic peptide located within the following region: EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; USP10; FXR2; MDM2; RNF2; BMI1; RPS27L; EDC4; RPL35; RPL14; EIF2B3; EIF3C; PTBP1; PIN1; PA2G4; YBX1; HNRNPU; FAU; SH3RF2; TARDBP; FBXO25; RIOK2; SND1; VCAM1; env; ITGA4; IL7R; FN1; EPHA8; DTX1; PABPC1; PAXIP1; ESR1; APP; NOLC1; TPM4; LCK; CSK; KCND3;
Blocking Peptide:
For anti-G3BP1 (ARP37713_T100) antibody is Catalog # AAP37713 (Previous Catalog # AAPP09045)
Datasheets/Manuals:
Printable datasheet for anti-G3BP1 (ARP37713_T100) antibody
Target Reference:
Kociok,N., et al., (1999) J. Cell. Biochem. 74 (2), 194-201
Publications:

Lind, K; Svedin, E; Domsgen, E; Kapell, S; Laitinen, O; Moll, M; Flodström-Tullberg, M; Coxsackievirus counters the host innate immune response by blocking type III interferon expression. 97, 1-12 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 26935471

Schulte, T; Liu, L; Panas, MD; Thaa, B; Dickson, N; Götte, B; Achour, A; McInerney, GM; Combined structural, biochemical and cellular evidence demonstrates that both FGDF motifs in alphavirus nsP3 are required for efficient replication. 6, (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27383630

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...