Search Antibody, Protein, and ELISA Kit Solutions

G3BP Antibody - N-terminal region (ARP37713_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37713_T100-FITC Conjugated

ARP37713_T100-HRP Conjugated

ARP37713_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-174777 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-G3BP (ARP37713_T100)
Peptide Sequence:
Synthetic peptide located within the following region: EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-G3BP1 (ARP37713_T100) antibody is Catalog # AAP37713 (Previous Catalog # AAPP09045)
Printable datasheet for anti-G3BP1 (ARP37713_T100) antibody
Target Reference:
Kociok,N., et al., (1999) J. Cell. Biochem. 74 (2), 194-201

Lind, K; Svedin, E; Domsgen, E; Kapell, S; Laitinen, O; Moll, M; Flodström-Tullberg, M; Coxsackievirus counters the host innate immune response by blocking type III interferon expression. 97, 1-12 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 26935471

Schulte, T; Liu, L; Panas, MD; Thaa, B; Dickson, N; Götte, B; Achour, A; McInerney, GM; Combined structural, biochemical and cellular evidence demonstrates that both FGDF motifs in alphavirus nsP3 are required for efficient replication. 6, (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27383630

Gene Symbol:
Official Gene Full Name:
GTPase activating protein (SH3 domain) binding protein 1
Alias Symbols:
NCBI Gene Id:
Protein Name:
Ras GTPase-activating protein-binding protein 1
Description of Target:
G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express G3BP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express G3BP.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...