Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37713_T100-FITC Conjugated

ARP37713_T100-HRP Conjugated

ARP37713_T100-Biotin Conjugated

G3BP Antibody - N-terminal region (ARP37713_T100)

Catalog#: ARP37713_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-174777 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-G3BP (ARP37713_T100)
Peptide Sequence Synthetic peptide located within the following region: EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-G3BP1 (ARP37713_T100) antibody is Catalog # AAP37713 (Previous Catalog # AAPP09045)
Datasheets/Manuals Printable datasheet for anti-G3BP1 (ARP37713_T100) antibody
Target Reference Kociok,N., et al., (1999) J. Cell. Biochem. 74 (2), 194-201

Lind, K; Svedin, E; Domsgen, E; Kapell, S; Laitinen, O; Moll, M; Flodström-Tullberg, M; Coxsackievirus counters the host innate immune response by blocking type III interferon expression. 97, 1-12 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 26935471

Schulte, T; Liu, L; Panas, MD; Thaa, B; Dickson, N; Götte, B; Achour, A; McInerney, GM; Combined structural, biochemical and cellular evidence demonstrates that both FGDF motifs in alphavirus nsP3 are required for efficient replication. 6, (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27383630

Gene Symbol G3BP1
Official Gene Full Name GTPase activating protein (SH3 domain) binding protein 1
Alias Symbols G3BP, HDH-VIII
NCBI Gene Id 10146
Protein Name Ras GTPase-activating protein-binding protein 1
Description of Target G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Swissprot Id Q13283
Protein Accession # NP_005745
Nucleotide Accession # NM_005754
Protein Size (# AA) 466
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express G3BP.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express G3BP.
Protein Interactions UBC; USP10; FXR2; MDM2; RNF2; BMI1; RPS27L; EDC4; RPL35; RPL14; EIF2B3; EIF3C; PTBP1; PIN1; PA2G4; YBX1; HNRNPU; FAU; SH3RF2; TARDBP; FBXO25; RIOK2; SND1; VCAM1; env; ITGA4; IL7R; FN1; EPHA8; DTX1; PABPC1; PAXIP1; ESR1; APP; NOLC1; TPM4; LCK; CSK; KCND3;
  1. What is the species homology for "G3BP Antibody - N-terminal region (ARP37713_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "G3BP Antibody - N-terminal region (ARP37713_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "G3BP Antibody - N-terminal region (ARP37713_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "G3BP Antibody - N-terminal region (ARP37713_T100)"?

    This target may also be called "G3BP, HDH-VIII" in publications.

  5. What is the shipping cost for "G3BP Antibody - N-terminal region (ARP37713_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "G3BP Antibody - N-terminal region (ARP37713_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "G3BP Antibody - N-terminal region (ARP37713_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "G3BP Antibody - N-terminal region (ARP37713_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "G3BP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "G3BP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "G3BP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "G3BP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "G3BP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "G3BP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:G3BP Antibody - N-terminal region (ARP37713_T100)
Your Rating
We found other products you might like!