Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51279_P050 Unconjugated

ARP51279_P050-HRP Conjugated

ARP51279_P050-Biotin Conjugated

FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)

Catalog#: ARP51279_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-166714 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FZR1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-FZR1 (ARP51279_P050)
Peptide Sequence Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
Concentration 0.5 mg/ml
Blocking Peptide For anti-FZR1 (ARP51279_P050-FITC) antibody is Catalog # AAP51279 (Previous Catalog # AAPS22306)
Datasheets/Manuals Printable datasheet for anti-FZR1 (ARP51279_P050-FITC) antibody
Sample Type Confirmation

FZR1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Gene Symbol FZR1
Official Gene Full Name Fizzy/cell division cycle 20 related 1 (Drosophila)
Alias Symbols CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1, KIAA1242
NCBI Gene Id 51343
Protein Name Fizzy-related protein homolog
Description of Target FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Swissprot Id Q9UM11
Protein Accession # NP_057347
Nucleotide Accession # NM_016263
Protein Size (# AA) 493
Molecular Weight 55kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FZR1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FZR1.
  1. What is the species homology for "FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)"?

    This target may also be called "CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1, KIAA1242" in publications.

  5. What is the shipping cost for "FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FZR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FZR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FZR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FZR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FZR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FZR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FZR1 Antibody - N-terminal region : FITC (ARP51279_P050-FITC)
Your Rating
We found other products you might like!