Search Antibody, Protein, and ELISA Kit Solutions

FZR1 Antibody - N-terminal region : Biotin (ARP51279_P050-Biotin)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51279_P050 Unconjugated

ARP51279_P050-FITC Conjugated

ARP51279_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-166714 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FZR1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-FZR1 (ARP51279_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-FZR1 (ARP51279_P050-Biotin) antibody is Catalog # AAP51279 (Previous Catalog # AAPS22306)
Datasheets/Manuals:
Printable datasheet for anti-FZR1 (ARP51279_P050-Biotin) antibody
Sample Type Confirmation:

FZR1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Gene Symbol:
FZR1
Official Gene Full Name:
Fizzy/cell division cycle 20 related 1 (Drosophila)
Alias Symbols:
CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1, KIAA1242
NCBI Gene Id:
51343
Protein Name:
Fizzy-related protein homolog
Description of Target:
FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Swissprot Id:
Q9UM11
Protein Accession #:
NP_057347
Nucleotide Accession #:
NM_016263
Protein Size (# AA):
493
Molecular Weight:
55kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FZR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FZR1.
Protein Interactions:
ZC3HC1; CDC25A; CCNB1; UBE2S; UBE2C; PTTG1; UBE2D2; TP53; CDR2; UBE2K; ANAPC4; PDS1; STAU1; CDK2; CDC27; RACGAP1; FOXM1; HECW2; PHF8; BTRC; CCNA1; UBC; SOX2; SKP2; PLK1; CUL1; CUEDC2; CDC20; kif22; SIRT2; CLSPN; ANAPC11; CDC14B; VHL; PTEN; EYA1; DAXX; BUB

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...